4Q94: Human RPRD1B CID

human RPRD1B CID in complex with a RPB1-CTD derived Ser2 phosphorylated peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 18 Jun 2014.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,366
Mol. weight: 36.14 kDa
Released: 18 Jun 2014

Explore 4Q94 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Q94 contains 19 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-15	10
β-strand	19	1	1
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-55	3
α-helix	56-70	15
α-helix	76-82	7
α-helix	85-113	29
α-helix	119-129	11

Chain B: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-15	10
β-strand	19	1	2
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-55	3
α-helix	56-70	15
α-helix	76-113	38
α-helix	119-128	10

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1620	1
β-strand	1621	1	1
α-helix	1622	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1621	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1B	A, B	protein	135	Homo sapiens	Q9NQG5 (AlphaFold model)
rpb1-ctd	C, D	protein	21

Sequence of entity 1 (A, B), FASTA

>4Q94_1 Regulation of nuclear pre-mRNA domain-containing protein 1B (chains A, B)
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFL
YLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGE
FIQQLKLSMEDSKSP

Sequence of entity 2 (C, D), FASTA

>4Q94_2 rpb1-ctd (chains C, D)
XSPSYSPTSPSYSPTSPSYSX

Primary citation

RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation. Ni, Z., Xu, C., Guo, X. et al. Nat Struct Mol Biol (2014) 21:686-695. DOI 10.1038/nsmb.2853 · PubMed

Other PDB entries of the same protein (UniProt Q9NQG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q96 1.85 Å, CID of human RPRD1B in complex with an unmodified CTD peptide
4FU3 1.9 Å, CID of human RPRD1B
4HFG 2.0 Å, CID of human RPRD1B
4FLA 2.2 Å, Crystal structure of human RPRD1B, carboxy-terminal domain
9B9L 2.5 Å, RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide
4NAD 2.8 Å, Crystal Structure of the C-terminal Domain of CREPT

Browse structure collections

About this viewer

MolViewer shows 4Q94 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.