4HFG: CID of human RPRD1B

CID of human RPRD1B. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Oct 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,201
Mol. weight: 31.7 kDa
Released: 17 Oct 2012

Explore 4HFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HFG contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	6-14	9
α-helix	17-18	2
α-helix	19-21	3
α-helix	23-32	10
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-70	18
α-helix	76-81	6
α-helix	85-95	11
α-helix	97	1
α-helix	101-113	13
α-helix	119-130	12

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	6-14	9
α-helix	16-18	3
α-helix	19-21	3
α-helix	23-32	10
α-helix	34-36	3
α-helix	37-50	14
α-helix	56-70	15
α-helix	76-82	7
α-helix	85-95	11
α-helix	97	1
α-helix	101-113	13
α-helix	119-129	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1B	A, B	protein	135	Homo sapiens	Q9NQG5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4HFG_1 Regulation of nuclear pre-mRNA domain-containing protein 1B (chains A, B)
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFL
YLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGE
FIQQLKLSMEDSKSP

Primary citation

CID of human RPRD1B. Ni, Z., Xu, C., Tempel, W. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NQG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q94 1.85 Å, human RPRD1B CID in complex with a RPB1-CTD derived Ser2 phosphorylated peptide
4Q96 1.85 Å, CID of human RPRD1B in complex with an unmodified CTD peptide
4FU3 1.9 Å, CID of human RPRD1B
4FLA 2.2 Å, Crystal structure of human RPRD1B, carboxy-terminal domain
9B9L 2.5 Å, RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide
4NAD 2.8 Å, Crystal Structure of the C-terminal Domain of CREPT

Browse structure collections

About this viewer

MolViewer shows 4HFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.