4FP7: DNA mismatch repair protein HSM3

Name: PDB 4FP7: 2.2A resolution structure of Proteasome Assembly Chaperone Hsm3
Published: 2013-04-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

2.2A resolution structure of Proteasome Assembly Chaperone Hsm3. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 7,286
Mol. weight: 113.37 kDa
Released: 10 Apr 2013

Explore 4FP7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FP7 contains 78 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 0 β-strands

Element	Residues	Length
α-helix	21-31	11
α-helix	40-53	14
α-helix	63-74	12
α-helix	84-94	11
α-helix	100-106	7
α-helix	109-116	8
α-helix	121-132	12
α-helix	137-142	6
α-helix	145-153	9
α-helix	161-174	14
α-helix	178-182	5
α-helix	183-187	5
α-helix	189-198	10
α-helix	201-215	15
α-helix	225-228	4
α-helix	232-238	7
α-helix	242-261	20
α-helix	265-267	3
α-helix	268-271	4
α-helix	272-274	3
α-helix	275-283	9
α-helix	289-306	18
α-helix	315-320	6
α-helix	321-325	5
α-helix	331-333	3
α-helix	334-340	7
α-helix	343-349	7
α-helix	351-357	7
α-helix	365-371	7
α-helix	375-381	7
α-helix	382-384	3
α-helix	387-391	5
α-helix	395-405	11
α-helix	409-418	10
α-helix	420-427	8
α-helix	432-434	3
α-helix	438-452	15
α-helix	456-459	4
α-helix	460-462	3
α-helix	463-475	13

Chain B: 38 helices, 0 β-strands

Element	Residues	Length
α-helix	42-53	12
α-helix	63-73	11
α-helix	84-94	11
α-helix	95-97	3
α-helix	100-106	7
α-helix	109-117	9
α-helix	121-132	12
α-helix	139-142	4
α-helix	145-153	9
α-helix	161-174	14
α-helix	178-185	8
α-helix	189-198	10
α-helix	201-214	14
α-helix	215-217	3
α-helix	220-222	3
α-helix	225-228	4
α-helix	232-238	7
α-helix	242-261	20
α-helix	265-267	3
α-helix	268-271	4
α-helix	275-283	9
α-helix	289-306	18
α-helix	315-320	6
α-helix	321-325	5
α-helix	331-333	3
α-helix	334-340	7
α-helix	343-357	15
α-helix	365-371	7
α-helix	375-379	5
α-helix	382-384	3
α-helix	387-391	5
α-helix	395-405	11
α-helix	409-418	10
α-helix	420-427	8
α-helix	438-452	15
α-helix	455-459	5
α-helix	460-462	3
α-helix	463-475	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA mismatch repair protein HSM3	A, B	protein	491	Saccharomyces cerevisiae	P38348 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4FP7_1 DNA mismatch repair protein HSM3 (chains A, B)
GPLTRRASVGSMSEKETNYVENLLTQLENELNEDNLPEDINTLLRKCSLNLVTVVSLPDM
DVKPLLATIKRFLTSNVSYDSLNYDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEI
DPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELI
RRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVE
DILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLL
QLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHV
SGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMP
KVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGKNYS
TGSETKIADCR

Primary citation

2.2A resolution structure of Proteasome Assembly Chaperone Hsm3. Singh, R., Lovell, S., Zolkiewski, M. et al. To be published.

Other PDB entries of the same protein (UniProt P38348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VLD 2.05 Å, Crystal structure of yeast proteasome interacting protein
4A3T 2.1 Å, yeast regulatory particle proteasome assembly chaperone Hsm3
3VLE 2.41 Å, Crystal structure of yeast proteasome interacting protein
35ZR 2.99 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2 (base-Hsm3-Nas6 with…
35ZW 3.31 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2-Rpt3-Rpt4-Rpt5…
3VLF 3.8 Å, Crystal structure of yeast proteasome interacting protein
4A3V 3.8 Å, yeast regulatory particle proteasome assembly chaperone Hsm3 in complex with Rpt1…
36BM 3.82 Å, yeast 26S proteasome base assembly intermediate, base-Hsm3-Nas6 with Rpt4-EQ
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ
4JPO 5.0 Å, 5A resolution structure of Proteasome Assembly Chaperone Hsm3 in complex with a…

Browse structure collections

About this viewer

MolViewer shows 4FP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.