4FU9: Urokinase

Crystal Structure of the Urokinase. Determined by X-ray diffraction at 1.6 Å resolution. Released 22 Aug 2012.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,379
Mol. weight: 29.08 kDa
Ligands: 675, SIN
Released: 22 Aug 2012

Explore 4FU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FU9 contains 11 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	5-6	2	2
α-helix	9-11	3
β-strand	15-21	7	3
α-helix	22	1
β-strand	27-37	11	3
β-strand	40-43	4	3
α-helix	45-47	3
α-helix	54-56	3
β-strand	57-61	5	3
β-strand	65	1	4
β-strand	74-83	10	3
β-strand	88-89	2	5
β-strand	94-95	2	5
β-strand	99-104	6	3
β-strand	121	1	2
α-helix	122-123	2
α-helix	128-130	3
β-strand	134-139	6	2
α-helix	150-151	2
β-strand	153	1	4
β-strand	155-162	8	2
α-helix	164-167	4
α-helix	174-176	3
β-strand	181-185	5	2
β-strand	192	1	1
β-strand	201-206	6	2
β-strand	209-218	10	2
β-strand	224	1	6
β-strand	227	1	6
β-strand	229-233	5	2
α-helix	234-237	4
α-helix	238-245	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase-type plasminogen activator	A	protein	246	Homo sapiens	P00749 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FU9_1 Urokinase-type plasminogen activator (chains A)
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
ALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTK

Ligands and cofactors

ID	Name	Formula	Copies
675	6-[(Z)-amino(imino)methyl]-N-phenyl-2-naphthamide	C18 H15 N3 O	1
SIN	Succinic acid	C4 H6 O4	1

Water and common crystallization additives (ACT, GOL, SO4) are not listed.

Primary citation

Crystal Structure of the Urokinase. Kang, Y.N., Stuckey, J.A., Nienaber, V. et al. To be published.

Other PDB entries of the same protein (UniProt P00749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YC6 1.18 Å, The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
4ZKO 1.29 Å, The crystal structure of upain-1-W3A in complex with uPA at pH7.4
4ZKN 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH5.5
4ZKR 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH9.0
6XVD 1.4 Å, Crystal structure of complex of urokinase and a upain-1 variant(W3F) in pH7.4 condition
2O8T 1.45 Å, Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator…
3MHW 1.45 Å, The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
5Z1C 1.45 Å, The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
5WXF 1.46 Å, Crystal structure of uPA in complex with upain-2-2
4MNW 1.49 Å, Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic…
1GJ7 1.5 Å, Engineering inhibitors highly selective for the S1 sites of SER190 trypsin-like serine…
4XSK 1.5 Å, Structure of PAItrap, an uPA mutant

Browse structure collections

About this viewer

MolViewer shows 4FU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.