Human aminopeptidase N (CD13). Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Sept 2012.
Explore 4FYQ in 3D Show helices and sheets RCSB PDB PDBe
4FYQ contains 50 α-helices and 39 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 70-72 | 3 | |
| α-helix | 76-77 | 2 | |
| β-strand | 80-91 | 12 | 1 |
| β-strand | 102-113 | 12 | 1 |
| β-strand | 119-123 | 5 | 2 |
| β-strand | 128-129 | 2 | 1 |
| α-helix | 130-131 | 2 | |
| β-strand | 132 | 1 | 3 |
| β-strand | 135 | 1 | 3 |
| β-strand | 137-141 | 5 | 1 |
| α-helix | 147-149 | 3 | |
| β-strand | 150-156 | 7 | 2 |
| β-strand | 161-166 | 6 | 2 |
| α-helix | 169-171 | 3 | |
| β-strand | 174-185 | 12 | 1 |
| β-strand | 192-200 | 9 | 4 |
| β-strand | 203-211 | 9 | 4 |
| α-helix | 217-219 | 3 | |
| β-strand | 223 | 1 | 2 |
| β-strand | 231 | 1 | 5 |
| β-strand | 232-240 | 9 | 1 |
| β-strand | 244-247 | 4 | 4 |
| β-strand | 251 | 1 | 6 |
| β-strand | 256-257 | 2 | 1 |
| β-strand | 264-268 | 5 | 1 |
| β-strand | 269 | 1 | 6 |
| α-helix | 270-273 | 4 | |
| β-strand | 275 | 1 | 5 |
| α-helix | 277-279 | 3 | |
| β-strand | 282-285 | 4 | 4 |
| β-strand | 288-293 | 6 | 7 |
| β-strand | 299-304 | 6 | 7 |
| α-helix | 306-310 | 5 | |
| α-helix | 315-331 | 17 | |
| β-strand | 340-346 | 7 | 7 |
| β-strand | 353-354 | 2 | 7 |
| β-strand | 359-363 | 5 | 7 |
| α-helix | 364-367 | 4 | |
| α-helix | 376-394 | 19 | |
| β-strand | 395 | 1 | 8 |
| β-strand | 399-401 | 3 | 8 |
| α-helix | 404-406 | 3 | |
| α-helix | 408-425 | 18 | |
| α-helix | 431-434 | 4 | |
| α-helix | 435 | 1 | |
| α-helix | 436-441 | 6 | |
| α-helix | 442-447 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 465-470 | 6 | |
| α-helix | 474 | 1 | |
| α-helix | 475-479 | 5 | |
| α-helix | 480-491 | 12 | |
| α-helix | 493-507 | 15 | |
| β-strand | 510-512 | 3 | 8 |
| α-helix | 514-527 | 14 | |
| α-helix | 536-544 | 9 | |
| β-strand | 550-555 | 6 | 9 |
| β-strand | 560-565 | 6 | 9 |
| β-strand | 586-588 | 3 | 10 |
| β-strand | 590-592 | 3 | 11 |
| β-strand | 595-596 | 2 | 11 |
| β-strand | 600-602 | 3 | 10 |
| β-strand | 606-608 | 3 | 9 |
| α-helix | 610-612 | 3 | |
| β-strand | 620-622 | 3 | 11 |
| α-helix | 624-626 | 3 | |
| β-strand | 631-634 | 4 | 9 |
| α-helix | 636-649 | 14 | |
| α-helix | 650-652 | 3 | |
| α-helix | 655-670 | 16 | |
| α-helix | 676-681 | 6 | |
| α-helix | 684-688 | 5 | |
| α-helix | 692-709 | 18 | |
| α-helix | 715-736 | 22 | |
| α-helix | 747-762 | 16 | |
| α-helix | 766-781 | 16 | |
| α-helix | 790-792 | 3 | |
| α-helix | 793-803 | 11 | |
| α-helix | 806-817 | 12 | |
| α-helix | 824-831 | 8 | |
| α-helix | 832-834 | 3 | |
| α-helix | 838-848 | 11 | |
| α-helix | 856-858 | 3 | |
| α-helix | 859-868 | 10 | |
| α-helix | 872-889 | 18 | |
| α-helix | 900-906 | 7 | |
| α-helix | 912-925 | 14 | |
| α-helix | 931-933 | 3 | |
| α-helix | 934-965 | 32 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aminopeptidase N | A | protein | 903 | Homo sapiens | P15144 (AlphaFold model) |
>4FYQ_1 Aminopeptidase N (chains A) PDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHS KKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEG ELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLT ALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIRIWA RPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRE NSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADY AEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVL RMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWT LQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYWLID VRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIIND AFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKK QVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPN NNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRY LSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQA VTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTE NSK
Water and common crystallization additives (ACY, SO4) are not listed.
The X-ray Crystal Structure of Human Aminopeptidase N Reveals a Novel Dimer and the Basis for Peptide Processing. Wong, A.H., Zhou, D., Rini, J.M. J Biol Chem (2012) 287:36804-36813. DOI 10.1074/jbc.M112.398842 · PubMed
Other PDB entries of the same protein (UniProt P15144 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FYQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.