Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78). Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Jul 2012.
Explore 4G3O in 3D Show helices and sheets RCSB PDB PDBe
4G3O contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 447-467 | 21 | |
| α-helix | 473-483 | 11 | |
| α-helix | 486-494 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase AMFR | A | protein | 58 | Homo sapiens | Q9UKV5 (AlphaFold model) |
>4G3O_1 E3 ubiquitin-protein ligase AMFR (chains A) GSMGYRGSENLYFQGQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRI
Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78). Kozlov, G., LePage, K., Gehring, K. To be published.
Other PDB entries of the same protein (UniProt Q9UKV5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4G3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.