4GA0: N-terminal domain of Nup358

Structure of the N-terminal domain of Nup358. Determined by X-ray diffraction at 1.15 Å resolution. Released 26 Sept 2012.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,472
Mol. weight: 17.35 kDa
Released: 26 Sept 2012

Explore 4GA0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GA0 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	20-24	5
α-helix	27-36	10
α-helix	40-53	14
α-helix	58-70	13
α-helix	74-87	14
α-helix	92-105	14
α-helix	110-122	13
α-helix	127-139	13
α-helix	140-142	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 SUMO-protein ligase RanBP2	A	protein	150	Homo sapiens	P49792

Sequence of entity 1 (A), FASTA

>4GA0_1 E3 SUMO-protein ligase RanBP2 (chains A)
GPLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINV
QERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAK
YWLERAAKLFPGSPAIYKLKEQLLDCEGED

Primary citation

Crystal structure of the N-terminal domain of Nup358/RanBP2. Kassube, S.A., Stuwe, T., Lin, D.H. et al. J Mol Biol (2012) 423:752-765. DOI 10.1016/j.jmb.2012.08.026 · PubMed

Other PDB entries of the same protein (UniProt P49792), best resolution first:

7MNK 1.1 Å, Crystal structure of the tetramerization element of NUP358/RanBP2 (residues 805-832)
4I9Y 1.75 Å, Structure of the C-terminal domain of Nup358
7MNR 1.8 Å, Crystal Structure of the ZnF3 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNV 1.8 Å, Crystal Structure of the ZnF8 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
4LQW 1.95 Å, Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
7MNU 2.0 Å, Crystal Structure of the ZnF7 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNP 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNQ 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNS 2.1 Å, Crystal Structure of the ZnF4 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
3UIP 2.29 Å, Complex between human RanGAP1-SUMO1, UBC9 and the IR1 domain from RanBP2 containing IR2…
7MNZ 2.35 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 4 in complex with Ran-GPPNHP
7MNW 2.4 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 1 in complex with Ran-GPPNHP

Browse structure collections

About this viewer

MolViewer shows 4GA0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.