4I9Y: C-terminal domain of Nup358

Structure of the C-terminal domain of Nup358. Determined by X-ray diffraction at 1.75 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 6
Atoms: 9,776
Mol. weight: 112.92 kDa
Ligands: TLA
Released: 30 Jan 2013

Explore 4I9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I9Y contains 18 α-helices and 72 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52-57	6	1
β-strand	61-64	4	1
β-strand	77	1	2
β-strand	80	1	2
β-strand	83	1	3
β-strand	97-100	4	1
β-strand	108	1	3
β-strand	112-115	4	1
α-helix	120-122	3
β-strand	128-134	7	1
α-helix	136-143	8
β-strand	156-163	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 SUMO-protein ligase RanBP2	A, B, C, D, E, F	protein	167	Homo sapiens	P49792

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4I9Y_1 E3 SUMO-protein ligase RanBP2 (chains A, B, C, D, E, F)
GPHMTNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVI
PDFVCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLK
KAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI

Ligands and cofactors

ID	Name	Formula	Copies
TLA	L(+)-tartaric acid	C4 H6 O6	3

Water and common crystallization additives (CL, GOL) are not listed.

Primary citation

Structural and Functional Analysis of the C-Terminal Domain of Nup358/RanBP2. Lin, D.H., Zimmermann, S., Stuwe, T. et al. J Mol Biol (2013) 425:1318-1329. DOI 10.1016/j.jmb.2013.01.021 · PubMed

Other PDB entries of the same protein (UniProt P49792), best resolution first:

7MNK 1.1 Å, Crystal structure of the tetramerization element of NUP358/RanBP2 (residues 805-832)
4GA0 1.15 Å, Structure of the N-terminal domain of Nup358
7MNR 1.8 Å, Crystal Structure of the ZnF3 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNV 1.8 Å, Crystal Structure of the ZnF8 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
4LQW 1.95 Å, Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
7MNU 2.0 Å, Crystal Structure of the ZnF7 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNP 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNQ 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
7MNS 2.1 Å, Crystal Structure of the ZnF4 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
3UIP 2.29 Å, Complex between human RanGAP1-SUMO1, UBC9 and the IR1 domain from RanBP2 containing IR2…
7MNZ 2.35 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 4 in complex with Ran-GPPNHP
7MNW 2.4 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 1 in complex with Ran-GPPNHP

Browse structure collections

About this viewer

MolViewer shows 4I9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.