7MNK: Tetramerization element of NUP358/RanBP2
Crystal structure of the tetramerization element of NUP358/RanBP2 (residues 805-832). Determined by X-ray diffraction at 1.1 Å resolution. Released 15 Jun 2022.
- Method
- X-ray diffraction
- Resolution
- 1.1 Å
- Organism
- Homo sapiens
- Chains
- 4
- Atoms
- 1,487
- Mol. weight
- 14.91 kDa
- Released
- 15 Jun 2022
Explore 7MNK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7MNK contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 804-830 | 27 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 808-827 | 20 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 804-831 | 28 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 804-827 | 24 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| E3 SUMO-protein ligase RanBP2 | A, B, C, D | protein | 30 | Homo sapiens | P49792 |
Sequence of entity 1 (A, B, C, D), FASTA
>7MNK_1 E3 SUMO-protein ligase RanBP2 (chains A, B, C, D)
SYEDQNSLLKMICQQVEAIKKEMQELKLNS
Primary citation
Architecture of the cytoplasmic face of the nuclear pore. Bley, C.J., Nie, S., Mobbs, G.W. et al. Science (2022) 376:eabm9129-eabm9129. DOI 10.1126/science.abm9129 · PubMed
Other PDB entries of the same protein (UniProt P49792), best resolution first:
- 4GA0 1.15 Å, Structure of the N-terminal domain of Nup358
- 4I9Y 1.75 Å, Structure of the C-terminal domain of Nup358
- 7MNR 1.8 Å, Crystal Structure of the ZnF3 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 7MNV 1.8 Å, Crystal Structure of the ZnF8 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 4LQW 1.95 Å, Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
- 7MNU 2.0 Å, Crystal Structure of the ZnF7 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 7MNP 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 7MNQ 2.05 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 7MNS 2.1 Å, Crystal Structure of the ZnF4 of Nucleoporin NUP358/RanBP2 in complex with Ran-GDP
- 3UIP 2.29 Å, Complex between human RanGAP1-SUMO1, UBC9 and the IR1 domain from RanBP2 containing IR2…
- 7MNZ 2.35 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 4 in complex with Ran-GPPNHP
- 7MNW 2.4 Å, Crystal Structure of Nup358/RanBP2 Ran-binding domain 1 in complex with Ran-GPPNHP
Browse structure collections
About this viewer
MolViewer shows 7MNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.