4GFT: Myosin A tail domain interacting protein

Malaria invasion machinery protein-Nanobody complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 3 Jul 2013.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Plasmodium falciparum 3D7, LAMA GLAMA
Chains: 2
Atoms: 1,562
Mol. weight: 22.72 kDa
Released: 3 Jul 2013

Explore 4GFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GFT contains 10 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	141-151	11
β-strand	158-160	3	1
α-helix	161-169	9
α-helix	177-187	11
β-strand	192-194	3	1
α-helix	195-198	4
α-helix	199-203	5

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	2
β-strand	11-13	3	3
β-strand	19-27	9	2
α-helix	31-33	3
β-strand	36-41	6	3
β-strand	48-53	6	3
β-strand	60-62	3	3
α-helix	64-66	3
β-strand	70-75	6	2
α-helix	76-78	3
β-strand	80-85	6	2
α-helix	90-92	3
β-strand	94-100	7	3
α-helix	110-112	3
β-strand	115-116	2	3
β-strand	120-124	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin A tail domain interacting protein	A	protein	69	Plasmodium falciparum 3D7	Q8I4W8 (AlphaFold model)
Nanobody	B	protein	135	LAMA GLAMA

Sequence of entity 1 (A), FASTA

>4GFT_1 Myosin A tail domain interacting protein (chains A)
GDKDNVEELIKMFAHFDNNSTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDY
KLFCEDILQ

Sequence of entity 2 (B), FASTA

>4GFT_2 Nanobody (chains B)
QVQLQESGGGTVQPGGSLKLSCSAAPERAFSNYAMGWFRQAPGQEREFVAGITGSGRSQY
YADSVKGRFTISRDNAMNAVYLQMNSVKAEDTAVYYCAARVVPVFSDSTKGYVYWGQGTQ
VTVSSHHHHHHEPEA

Primary citation

The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody. Khamrui, S., Turley, S., Pardon, E. et al. Mol Biochem Parasitol (2013) 190:87-91. DOI 10.1016/j.molbiopara.2013.06.003 · PubMed

Other PDB entries of the same protein (UniProt Q8I4W8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MZJ 1.47 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[801,805], a…
2QAC 1.7 Å, The closed MTIP-MyosinA-tail complex from the malaria parasite invasion machinery
4MZK 1.82 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[807,811], a…
4AOM 1.94 Å, MTIP and MyoA complex
4R1E 1.98 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with a peptide-fragment…
4MZL 2.01 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with HBS myoA, a…
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6ZN3 2.51 Å, Plasmodium facliparum glideosome trimeric sub-complex
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state

Browse structure collections

About this viewer

MolViewer shows 4GFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.