4MZL: MTIP from Plasmodium falciparum

Crystal Structure of MTIP from Plasmodium falciparum in complex with HBS myoA, a hydrogen bond surrogate myoA helix mimetic. Determined by X-ray diffraction at 2.01 Å resolution. Released 6 Nov 2013.

Method: X-ray diffraction
Resolution: 2.01 Å
Organisms: Plasmodium falciparum 3D7, Plasmodium falciparum
Chains: 4
Atoms: 2,608
Mol. weight: 37.16 kDa
Released: 6 Nov 2013

Explore 4MZL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MZL contains 23 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	74-84	11
β-strand	86	1	1
β-strand	89	1	1
β-strand	90-91	2	2
α-helix	92-101	10
α-helix	108-118	11
β-strand	121-122	2	2
α-helix	124-133	10
α-helix	141-144	4
α-helix	146-151	6
β-strand	158-160	3	3
α-helix	161-170	10
α-helix	174-176	3
α-helix	177-187	11
β-strand	192-194	3	3
α-helix	195-203	9

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	68-71	4
α-helix	74-84	11
β-strand	86	1	4
β-strand	89	1	4
β-strand	90-91	2	5
α-helix	92-101	10
α-helix	108-118	11
β-strand	121-122	2	5
α-helix	124-133	10
α-helix	141-144	4
α-helix	146-151	6
β-strand	158-160	3	6
α-helix	161-170	10
α-helix	174-176	3
α-helix	177-187	11
β-strand	192-194	3	6
α-helix	195-202	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	801-815	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin A tail domain interacting protein	A, B	protein	145	Plasmodium falciparum 3D7	Q8I4W8 (AlphaFold model)
hydrogen bond surrogate (HBS) myoA helix mimetic	C, D	protein	17	Plasmodium falciparum	Q8IDR3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4MZL_1 Myosin A tail domain interacting protein (chains A, B)
GSVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYG
DNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQE
AIDALNAFSSEDNIDYKLFCEDILQ

Sequence of entity 2 (C, D), FASTA

>4MZL_2 hydrogen bond surrogate (HBS) myoA helix mimetic (chains C, D)
NIXSLLRVQAHIRKKMV

Primary citation

Crystal Structures of Stapled and Hydrogen Bond Surrogate Peptides Targeting a Fully Buried Protein-Helix Interaction. Douse, C.H., Maas, S.J., Thomas, J.C. et al. ACS Chem Biol (2014) 8:506-512. DOI 10.1021/cb500271c · PubMed

Other PDB entries of the same protein (UniProt Q8I4W8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MZJ 1.47 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[801,805], a…
4GFT 1.6 Å, Malaria invasion machinery protein-Nanobody complex
2QAC 1.7 Å, The closed MTIP-MyosinA-tail complex from the malaria parasite invasion machinery
4MZK 1.82 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[807,811], a…
4AOM 1.94 Å, MTIP and MyoA complex
4R1E 1.98 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with a peptide-fragment…
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6ZN3 2.51 Å, Plasmodium facliparum glideosome trimeric sub-complex
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state

Browse structure collections

About this viewer

MolViewer shows 4MZL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.