4GFX: N-terminal domain of TXNIP

Crystal structure of the N-terminal domain of TXNIP. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,310
Mol. weight: 17.15 kDa
Released: 5 Feb 2014

Explore 4GFX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GFX contains 2 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
β-strand	21	1	2
β-strand	26-35	10	1
β-strand	39-41	3	3
β-strand	43-52	10	4
β-strand	54-57	4	5
β-strand	60-64	5	5
β-strand	70-75	6	4
β-strand	78	1	1
α-helix	82	1
β-strand	89-91	3	3
β-strand	97-104	8	1
α-helix	105-106	2
β-strand	111-114	4	6
β-strand	118-119	2	6
β-strand	121-131	11	4
β-strand	134-143	10	4
β-strand	145	1	2
β-strand	148-150	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin-interacting protein	A	protein	151	Homo sapiens	Q9H3M7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GFX_1 Thioredoxin-interacting protein (chains A)
VAAIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQC
KQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDY
WVKAFLDRPSQPTQETKKNFEVVDLVDVNTP

Primary citation

The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein. Hwang, J., Suh, H.W., Jeon, Y.H. et al. Nat Commun (2014) 5:2958-2958. DOI 10.1038/ncomms3958 · PubMed

Other PDB entries of the same protein (UniProt Q9H3M7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CQ2 1.4 Å, Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
4GEI 1.5 Å, N-terminal domain of VDUP-1
5DZD 1.57 Å, Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide
5DWS 1.65 Å, Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
5DF6 1.78 Å, Crystal structure of PTPN11 tandem SH2 domains in complex with a TXNIP peptide
4ROJ 1.95 Å, Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
4LL1 2.0 Å, The structure of the TRX and TXNIP complex
4ROF 2.03 Å, Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide
4LL4 2.7 Å, The structure of the TRX and TXNIP complex
4GEJ 2.9 Å, N-terminal domain of VDUP-1

Browse structure collections

About this viewer

MolViewer shows 4GFX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.