The structure of the TRX and TXNIP complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 5 Feb 2014.
Explore 4LL4 in 3D Show helices and sheets RCSB PDB PDBe
4LL4 contains 14 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-14 | 6 | 1 |
| β-strand | 26-34 | 9 | 1 |
| β-strand | 39-41 | 3 | 2 |
| β-strand | 43-57 | 15 | 3 |
| β-strand | 62-76 | 15 | 3 |
| α-helix | 88 | 1 | |
| β-strand | 89-91 | 3 | 2 |
| β-strand | 97-104 | 8 | 1 |
| α-helix | 105-106 | 2 | |
| β-strand | 119-130 | 12 | 3 |
| α-helix | 135-136 | 2 | |
| β-strand | 137-143 | 7 | 3 |
| β-strand | 160-167 | 8 | 4 |
| β-strand | 177-184 | 8 | 4 |
| β-strand | 188-190 | 3 | 5 |
| α-helix | 193 | 1 | |
| β-strand | 194-203 | 10 | 4 |
| β-strand | 209 | 1 | 6 |
| β-strand | 210-223 | 14 | 7 |
| β-strand | 226-238 | 13 | 7 |
| β-strand | 242 | 1 | 6 |
| β-strand | 246-256 | 11 | 4 |
| β-strand | 269-281 | 13 | 7 |
| β-strand | 288-294 | 7 | 7 |
| β-strand | 295-297 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 8 |
| α-helix | 8-17 | 10 | |
| β-strand | 23-28 | 6 | 8 |
| α-helix | 33-48 | 16 | |
| β-strand | 53-58 | 6 | 8 |
| α-helix | 63-68 | 6 | |
| β-strand | 74 | 1 | 4 |
| β-strand | 76-81 | 6 | 8 |
| β-strand | 84-90 | 7 | 8 |
| α-helix | 94-102 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-14 | 6 | 9 |
| β-strand | 20-22 | 3 | 10 |
| β-strand | 26-34 | 9 | 9 |
| β-strand | 39-41 | 3 | 11 |
| β-strand | 43-58 | 16 | 12 |
| β-strand | 61-76 | 16 | 12 |
| β-strand | 89-91 | 3 | 11 |
| β-strand | 97-104 | 8 | 9 |
| α-helix | 105-106 | 2 | |
| β-strand | 114-116 | 3 | 12 |
| β-strand | 119-130 | 12 | 12 |
| β-strand | 137-143 | 7 | 12 |
| β-strand | 144-146 | 3 | 10 |
| β-strand | 160-167 | 8 | 13 |
| β-strand | 177-184 | 8 | 13 |
| β-strand | 188-190 | 3 | 14 |
| β-strand | 194-203 | 10 | 13 |
| β-strand | 209 | 1 | 15 |
| β-strand | 210-223 | 14 | 16 |
| β-strand | 226-238 | 13 | 16 |
| β-strand | 242 | 1 | 15 |
| α-helix | 243 | 1 | |
| β-strand | 246-256 | 11 | 13 |
| β-strand | 269-281 | 13 | 16 |
| β-strand | 288-294 | 7 | 16 |
| β-strand | 295-297 | 3 | 14 |
| β-strand | 298 | 1 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 17 |
| α-helix | 8-17 | 10 | |
| β-strand | 22-28 | 7 | 17 |
| α-helix | 33-48 | 16 | |
| β-strand | 52-58 | 7 | 17 |
| α-helix | 63-68 | 6 | |
| β-strand | 74 | 1 | 13 |
| β-strand | 76-81 | 6 | 17 |
| β-strand | 84-90 | 7 | 17 |
| α-helix | 94-104 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thioredoxin-interacting protein | A, C | protein | 315 | Homo sapiens | Q9H3M7 (AlphaFold model) |
| Thioredoxin | B, D | protein | 105 | Homo sapiens | P10599 (AlphaFold model) |
>4LL4_1 Thioredoxin-interacting protein (chains A, C) MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQ CKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVD YWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSSMFIPDGRVSVSA RIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGL SSRTSSMASRTSSEM
>4LL4_2 Thioredoxin (chains B, D) MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein. Hwang, J., Suh, H.W., Jeon, Y.H. et al. Nat Commun (2014) 5:2958-2958. DOI 10.1038/ncomms3958 · PubMed
Other PDB entries of the same protein (UniProt Q9H3M7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.