Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in complex with cadmium. Determined by X-ray diffraction at 1.6 Å resolution. Released 6 Feb 2013.
Explore 4GJE in 3D Show helices and sheets RCSB PDB PDBe
4GJE contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-9 | 7 | |
| α-helix | 14-25 | 12 | |
| β-strand | 35-37 | 3 | 1 |
| α-helix | 38-47 | 10 | |
| α-helix | 54-64 | 11 | |
| β-strand | 71-73 | 3 | 1 |
| α-helix | 74-85 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Troponin C, slow skeletal and cardiac muscles | A | protein | 89 | Homo sapiens | P63316 (AlphaFold model) |
>4GJE_1 Troponin C, slow skeletal and cardiac muscles (chains A) MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM IDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Water and common crystallization additives (ACT) are not listed.
The structure of cardiac troponin C regulatory domain with bound Cd(2+) reveals a closed conformation and unique ion coordination. Zhang, X.L., Tibbits, G.F., Paetzel, M. Acta Crystallogr D Biol Crystallogr (2013) 69:722-734. DOI 10.1107/S0907444913001182 · PubMed
Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4GJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.