4GLM: SH3 Domain of DNMBP protein [Homo sapiens]

Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,981
Mol. weight: 31.01 kDa
Released: 21 Nov 2012

Explore 4GLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GLM contains 8 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	247-250	4	1
β-strand	254	1	2
β-strand	261	1	1
α-helix	262-263	2
β-strand	264	1	2
β-strand	269-275	7	1
β-strand	280-285	6	1
β-strand	288-293	6	1
α-helix	294-296	3
β-strand	297-300	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynamin-binding protein	A, B, C, D	protein	72	Homo sapiens	Q6XZF7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4GLM_1 Dynamin-binding protein (chains A, B, C, D)
GGAAQPAMAQGALTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIF
PYRFVKLCPAAA

Primary citation

Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]. Guan, X., Dong, A., Huang, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q6XZF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CC2 1.55 Å, Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide -…
4CC3 1.97 Å, Complex of human Tuba C-terminal SH3 domain and Mena proline-rich peptide - H3
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
4CC4 2.6 Å, Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
1UG1 SH3 domain of Hypothetical protein BAA76854.1
1UHC Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]

Browse structure collections

About this viewer

MolViewer shows 4GLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.