Crystal structure of the T1L reovirus attachment protein sigma1 in complex with the GM2 glycan. Determined by X-ray diffraction at 3.6 Å resolution. Released 5 Dec 2012.
Explore 4GU3 in 3D Show helices and sheets RCSB PDB PDBe
4GU3 contains 15 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 268-269 | 2 | 1 |
| β-strand | 273-276 | 4 | 2 |
| β-strand | 283-286 | 4 | 2 |
| β-strand | 288 | 1 | 3 |
| β-strand | 293-296 | 4 | 4 |
| β-strand | 299-302 | 4 | 4 |
| α-helix | 305-309 | 5 | |
| β-strand | 310-311 | 2 | 5 |
| β-strand | 315-318 | 4 | 6 |
| β-strand | 323-326 | 4 | 6 |
| α-helix | 328-331 | 4 | |
| β-strand | 333-345 | 13 | 7 |
| β-strand | 348-361 | 14 | 7 |
| β-strand | 364-369 | 6 | 7 |
| β-strand | 372-375 | 4 | 7 |
| β-strand | 381-386 | 6 | 7 |
| β-strand | 391 | 1 | 7 |
| α-helix | 392 | 1 | |
| α-helix | 397-400 | 4 | |
| β-strand | 410-420 | 11 | 7 |
| β-strand | 423-437 | 15 | 7 |
| β-strand | 440-447 | 8 | 7 |
| β-strand | 455-458 | 4 | 7 |
| β-strand | 461-466 | 6 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 268-269 | 2 | 8 |
| β-strand | 273-276 | 4 | 1 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 1 |
| β-strand | 288 | 1 | 9 |
| β-strand | 293-296 | 4 | 3 |
| β-strand | 299-302 | 4 | 3 |
| α-helix | 305-309 | 5 | |
| β-strand | 310-311 | 2 | 10 |
| β-strand | 315-318 | 4 | 5 |
| β-strand | 323-326 | 4 | 5 |
| α-helix | 328-331 | 4 | |
| β-strand | 333-345 | 13 | 11 |
| β-strand | 348-361 | 14 | 11 |
| β-strand | 364-369 | 6 | 11 |
| α-helix | 370-371 | 2 | |
| β-strand | 372-375 | 4 | 11 |
| β-strand | 381-386 | 6 | 11 |
| β-strand | 391 | 1 | 11 |
| α-helix | 392 | 1 | |
| α-helix | 397-400 | 4 | |
| β-strand | 410-420 | 11 | 11 |
| β-strand | 423-437 | 15 | 11 |
| β-strand | 440-447 | 8 | 11 |
| β-strand | 455-458 | 4 | 11 |
| β-strand | 461-466 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 268-269 | 2 | 2 |
| β-strand | 273-276 | 4 | 8 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 8 |
| β-strand | 288 | 1 | 4 |
| β-strand | 293-296 | 4 | 9 |
| β-strand | 299-302 | 4 | 9 |
| α-helix | 305-309 | 5 | |
| β-strand | 310-311 | 2 | 6 |
| β-strand | 315-318 | 4 | 10 |
| β-strand | 323-326 | 4 | 10 |
| α-helix | 328-331 | 4 | |
| β-strand | 333-345 | 13 | 12 |
| β-strand | 348-361 | 14 | 12 |
| β-strand | 364-369 | 6 | 12 |
| β-strand | 372-375 | 4 | 12 |
| β-strand | 381-386 | 6 | 12 |
| β-strand | 391 | 1 | 12 |
| α-helix | 392 | 1 | |
| α-helix | 397-400 | 4 | |
| β-strand | 410-420 | 11 | 12 |
| β-strand | 423-437 | 15 | 12 |
| β-strand | 440-447 | 8 | 12 |
| β-strand | 455-458 | 4 | 12 |
| β-strand | 461-466 | 6 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Outer capsid protein sigma-1 | A, B, C | protein | 219 | Mammalian orthoreovirus 1 | P04506 |
>4GU3_1 Outer capsid protein sigma-1 (chains A, B, C) GVLNQGVTSLESAKIDSVLPPLTVREASGVRTLSFGYDTSDFTIINSVLSLRSRLTLPTY RYPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNLMKVDDWLVLSFSQ MTTNSIMADGKFVINFVSGLSSGWQTGDTEPSSTIDPLSTTFAAVQFLNNGQRIDAFRIM GVSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNVR
The GM2 Glycan Serves as a Functional Coreceptor for Serotype 1 Reovirus. Reiss, K., Stencel, J.E., Liu, Y. et al. PLoS Pathog (2012) 8:e1003078-e1003078. DOI 10.1371/journal.ppat.1003078 · PubMed
Other PDB entries of the same protein (UniProt P04506), best resolution first:
MolViewer shows 4GU3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.