4XC5: T1L reovirus attachment protein SIGMA1

Crystal structure of the T1L reovirus attachment protein SIGMA1. Determined by X-ray diffraction at 2.2 Å resolution. Released 1 Apr 2015.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mammalian orthoreovirus 1 Lang
Chains: 3
Atoms: 3,951
Mol. weight: 74.94 kDa
Ligands: MG
Released: 1 Apr 2015

Explore 4XC5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XC5 contains 9 α-helices and 42 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	310-311	2	1
β-strand	315-318	4	2
β-strand	323-326	4	2
α-helix	328-331	4
β-strand	333-345	13	3
β-strand	348-361	14	3
β-strand	364-369	6	3
β-strand	372-375	4	3
β-strand	381-386	6	3
β-strand	391	1	3
α-helix	392	1
α-helix	397-400	4
β-strand	410-420	11	3
β-strand	423-437	15	3
β-strand	440-448	9	3
β-strand	455-458	4	3
β-strand	461-466	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C	protein	218	Mammalian orthoreovirus 1 Lang	P04506

Sequence of entity 1 (A, B, C), FASTA

>4XC5_1 Outer capsid protein sigma-1 (chains A, B, C)
HHHHHHGSSNSGKQIEDKIEEILSKIYHIENEIARIKKLIGEGSGRGVLNQGVTSLPTYR
YPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNLMKVDDWLVLSFSQM
TTNSIMADGKFVINFVSGLSSGWQTGDTEPSSTIDPLSTTFAAVQFLNNGQRIDAFRIMG
VSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNVR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Water and common crystallization additives (CL, ACT, GOL) are not listed.

Primary citation

Structure of Serotype 1 Reovirus Attachment Protein sigma 1 in Complex with Junctional Adhesion Molecule A Reveals a Conserved Serotype-Independent Binding Epitope. Stettner, E., Dietrich, M.H., Reiss, K. et al. J Virol (2015) 89:6136-6140. DOI 10.1128/JVI.00433-15 · PubMed

Other PDB entries of the same protein (UniProt P04506), best resolution first:

6GAJ 1.35 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (iodide)
6GAK 1.43 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (chloride)
6GAO 2.1 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail and body
4ODB 3.2 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU4 3.5 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU3 3.6 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with the GM2…
5MHS 3.7 Å, T1L reovirus sigma1 complexed with 5C6 Fab fragments

Browse structure collections

About this viewer

MolViewer shows 4XC5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.