6GAO: T1L reovirus sigma1 coiled coil tail and body

Crystal structure of the T1L reovirus sigma1 coiled coil tail and body. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 Apr 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mammalian orthoreovirus 1 Lang
Chains: 3
Atoms: 5,294
Mol. weight: 76.9 kDa
Released: 25 Apr 2018

Explore 6GAO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GAO contains 6 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-178	151
β-strand	182-183	2	1
β-strand	187-190	4	2
β-strand	193-196	4	2
β-strand	198	1	3
β-strand	202-204	3	4
β-strand	210-212	3	4
α-helix	215-217	3
β-strand	221-224	4	5
β-strand	227-230	4	5
β-strand	232	1	6
β-strand	237-239	3	7
β-strand	245-247	3	7

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	26-178	153
β-strand	182-183	2	8
β-strand	187-190	4	1
β-strand	193-196	4	1
β-strand	198	1	9
β-strand	202-204	3	3
β-strand	210-212	3	3
α-helix	215-217	3
β-strand	221-224	4	10
β-strand	227-230	4	10
β-strand	232	1	11
β-strand	237-239	3	6
β-strand	245-247	3	6

Chain C: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	29-178	150
β-strand	182-183	2	2
β-strand	187-190	4	8
β-strand	193-196	4	8
β-strand	198	1	4
β-strand	202-204	3	9
β-strand	210-212	3	9
α-helix	215-217	3
β-strand	221-224	4	12
β-strand	227-230	4	12
β-strand	232	1	7
β-strand	237-239	3	11
β-strand	245-247	3	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C	protein	240	Mammalian orthoreovirus 1 Lang	P04506

Sequence of entity 1 (A, B, C), FASTA

>6GAO_1 Outer capsid protein sigma-1 (chains A, B, C)
GSHMEEIKKQVQVNVDDIRAANIKLDGLGRQIADISNSISTIESRLGEMDNRLVGISSQV
TQLSNSVSQNTQSISSLGDRINAVEPRVDSLDTVTSNLTGRTSTLEADVGSLRTELAALT
TRVTTEVTRLDGLINSGQNSIGELSTRLSNVETSMVTTAGRGLQKNGNTLNVIVGNGMWF
NSSNQLQLDLSGQSKGVGFVGTGMVVKIDTNYFAYNSNGEITLVSQINELPSRVSTLESA

Primary citation

Structural and Functional Features of the Reovirus sigma 1 Tail. Dietrich, M.H., Ogden, K.M., Long, J.M. et al. J Virol (2018) 92. DOI 10.1128/JVI.00336-18 · PubMed

Other PDB entries of the same protein (UniProt P04506), best resolution first:

6GAJ 1.35 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (iodide)
6GAK 1.43 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (chloride)
4XC5 2.2 Å, Crystal structure of the T1L reovirus attachment protein SIGMA1
4ODB 3.2 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU4 3.5 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU3 3.6 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with the GM2…
5MHS 3.7 Å, T1L reovirus sigma1 complexed with 5C6 Fab fragments

Browse structure collections

About this viewer

MolViewer shows 6GAO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.