5MHS: T1L reovirus sigma1

T1L reovirus sigma1 complexed with 5C6 Fab fragments. Determined by X-ray diffraction at 3.7 Å resolution. Released 21 Dec 2016.

Method: X-ray diffraction
Resolution: 3.7 Å
Organisms: Reovirus type 1 (strain Lang), Mus musculus
Chains: 9
Atoms: 11,874
Mol. weight: 200.73 kDa
Released: 21 Dec 2016

Explore 5MHS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MHS contains 47 α-helices and 173 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	310-311	2	1
β-strand	315-318	4	2
β-strand	323-326	4	2
α-helix	328-331	4
β-strand	333-345	13	3
β-strand	348-361	14	3
β-strand	364-369	6	3
β-strand	372-375	4	3
β-strand	381-386	6	3
β-strand	391	1	3
α-helix	392	1
α-helix	397-400	4
β-strand	410-420	11	3
β-strand	423-437	15	3
β-strand	440-448	9	3
β-strand	455-458	4	3
α-helix	459-460	2
β-strand	461-466	6	3

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	310-311	2	2
β-strand	315-318	4	4
β-strand	323-326	4	4
α-helix	328-331	4
β-strand	333-345	13	6
β-strand	348-361	14	6
β-strand	364-369	6	6
β-strand	372-375	4	6
β-strand	381-386	6	6
β-strand	391	1	6
α-helix	392	1
α-helix	397-400	4
β-strand	410-420	11	6
β-strand	423-437	15	6
β-strand	440-447	8	6
β-strand	455-458	4	6
α-helix	459-460	2
β-strand	461-466	6	6

Chain D: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	30-31	2	9
β-strand	34-35	2	9
β-strand	37-42	6	8
α-helix	47	1
β-strand	48-53	6	8
β-strand	57-58	2	8
α-helix	59	1
β-strand	67-70	4	7
β-strand	74-79	6	7
β-strand	89-94	6	8
β-strand	101	1	10
β-strand	102	1	8
α-helix	103-105	3
β-strand	106-110	5	8
β-strand	114	1	11
β-strand	117-120	4	12
α-helix	122-124	3
α-helix	125-130	6
β-strand	132-142	11	12
β-strand	143	1	11
β-strand	150-151	2	13
β-strand	152-153	2	14
β-strand	156-157	2	14
β-strand	162-166	5	12
α-helix	167-170	4
β-strand	176-185	10	12
α-helix	186-189	4
β-strand	195-199	5	13
α-helix	207	1
β-strand	208-212	5	13

Chain E: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	15
β-strand	11-12	2	16
β-strand	18-24	7	15
β-strand	32-39	8	10
β-strand	46-51	6	10
α-helix	52	1
β-strand	57-59	3	10
α-helix	61-63	3
β-strand	67-72	6	15
β-strand	77-82	6	15
β-strand	91-99	9	10
β-strand	113	1	10
β-strand	117-119	3	10
β-strand	120-121	2	16
α-helix	125-126	2
α-helix	128-129	2
β-strand	130-134	5	17
β-strand	146-155	10	17
β-strand	161-164	4	18
α-helix	165-167	3
β-strand	173-181	9	17
β-strand	184-193	10	17
β-strand	204-209	6	18
β-strand	214-219	6	18

Chain F: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-13	4	20
β-strand	19-25	7	19
β-strand	30-31	2	21
β-strand	34-35	2	21
β-strand	37-42	6	20
α-helix	47	1
β-strand	48-53	6	20
β-strand	57-58	2	20
α-helix	59	1
β-strand	68-70	3	19
β-strand	74-79	6	19
β-strand	89-94	6	20
β-strand	102	1	20
α-helix	103-105	3
β-strand	106-110	5	20
β-strand	114	1	22
β-strand	117-121	5	23
α-helix	122-124	3
α-helix	125-130	6
β-strand	132-142	11	23
β-strand	143	1	22
β-strand	148-150	3	24
β-strand	153	1	25
β-strand	156	1	25
β-strand	162-166	5	23
α-helix	167-170	4
β-strand	176-185	10	23
α-helix	186-189	4
β-strand	195	1	25
β-strand	198-200	3	24
α-helix	207-208	2

Chain G: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	26
β-strand	10-13	4	27
β-strand	19-25	7	26
β-strand	30-31	2	28
β-strand	34-35	2	28
β-strand	37-42	6	27
α-helix	47	1
β-strand	48-53	6	27
β-strand	57-58	2	27
α-helix	59	1
β-strand	66-70	5	26
β-strand	74-79	6	26
β-strand	89-94	6	27
β-strand	102	1	27
β-strand	106-110	5	27
β-strand	114	1	29
β-strand	117-121	5	30
α-helix	122-124	3
α-helix	125-130	6
β-strand	132-142	11	30
β-strand	143	1	29
β-strand	148-149	2	31
β-strand	162-167	6	30
α-helix	168-170	3
β-strand	176-185	10	30
α-helix	186-189	4
β-strand	199-200	2	31

Chain H: 3 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	32
β-strand	11	1	33
α-helix	16-17	2
β-strand	18-24	7	32
β-strand	32-39	8	34
β-strand	45-52	8	34
β-strand	56-59	4	34
α-helix	61-66	6
β-strand	67-72	6	32
β-strand	77-82	6	32
β-strand	92-99	8	34
β-strand	112-118	7	34
β-strand	120	1	33
β-strand	127	1	35
β-strand	131-133	3	36
β-strand	150-153	4	36
β-strand	156	1	35
α-helix	159	1
β-strand	161-164	4	37
β-strand	174-176	3	36
β-strand	180-181	2	38
β-strand	184-185	2	38
β-strand	186-190	5	36
β-strand	205-208	4	37

Chain N: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	39
β-strand	11	1	40
β-strand	19-25	7	39
β-strand	32-40	9	41
β-strand	44-51	8	41
α-helix	52	1
β-strand	57-59	3	41
α-helix	61-63	3
β-strand	64	1	39
β-strand	67-72	6	39
β-strand	77-82	6	39
α-helix	87-89	3
β-strand	91-99	9	41
β-strand	112-113	2	41
β-strand	117-119	3	41
β-strand	120	1	40
α-helix	125-126	2
β-strand	127	1	42
β-strand	145-153	9	43
β-strand	156	1	42
β-strand	161-164	4	44
α-helix	165-167	3
β-strand	173-175	3	43
β-strand	179-181	3	43
β-strand	184-194	11	43
β-strand	205-208	4	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C	protein	172	Reovirus type 1 (strain Lang)	P04506
5C6 Fab light chain	D, F, G	protein	217	Mus musculus
5C6 Fab heavy chain	E, H, N	protein	221	Mus musculus

Sequence of entity 1 (A, B, C), FASTA

>5MHS_1 Outer capsid protein sigma-1 (chains A, B, C)
GVLNQGVTSLPTYRYPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNL
MKVDDWLVLSFSQMTTNSIMADGKFVINFVSGLSSGWQTGDTEPSSTIDPLSTTFAAVQF
LNNGQRIDAFRIMGVSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNVR

Sequence of entity 2 (D, F, G), FASTA

>5MHS_2 5C6 Fab light chain (chains D, F, G)
DIVLTQSPASLAVSLGQRATISCRASKSVSTSGYSYMQWYQQKPGQPPKLLIYLASNLES
GVPVRFSGSGSGTDFTLNIHPVEEEDAAIYYCQHSRELPPTFGAGTKLELKADAAPTVSI
FPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (E, H, N), FASTA

>5MHS_3 5C6 Fab heavy chain (chains E, H, N)
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYAIHWVRQSPGKGLEWLGVIWSGGSTDYN
AAFISRLSISKDNFKSQVFFKMNSLQSNDTAIYYCARKEELYGYDGYLFFDVWGAGTTVT
VSSAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALL
QSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIE

Primary citation

Structural Insights into Reovirus sigma 1 Interactions with Two Neutralizing Antibodies. Dietrich, M.H., Ogden, K.M., Katen, S.P. et al. J Virol (2017) 91. DOI 10.1128/JVI.01621-16 · PubMed

Other PDB entries of the same protein (UniProt P04506), best resolution first:

6GAJ 1.35 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (iodide)
6GAK 1.43 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail (chloride)
6GAO 2.1 Å, Crystal structure of the T1L reovirus sigma1 coiled coil tail and body
4XC5 2.2 Å, Crystal structure of the T1L reovirus attachment protein SIGMA1
4ODB 3.2 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU4 3.5 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
4GU3 3.6 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with the GM2…

Browse structure collections

About this viewer

MolViewer shows 5MHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.