HSC70 NBD with Na, Cl and glycerol. Determined by X-ray diffraction at 1.64 Å resolution. Released 19 Mar 2014.
Explore 4H5R in 3D Show helices and sheets RCSB PDB PDBe
4H5R contains 39 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 1 |
| β-strand | 15-16 | 2 | 2 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 42-44 | 3 | 3 |
| β-strand | 49-51 | 3 | 3 |
| α-helix | 53-57 | 5 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 3 |
| α-helix | 70-73 | 4 | |
| α-helix | 81-86 | 6 | |
| α-helix | 87-89 | 3 | |
| β-strand | 93-97 | 5 | 4 |
| β-strand | 100-107 | 8 | 4 |
| β-strand | 110-114 | 5 | 4 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-200 | 8 | 5 |
| β-strand | 205-213 | 9 | 5 |
| β-strand | 216-225 | 10 | 5 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-274 | 18 | |
| β-strand | 279-288 | 10 | 6 |
| β-strand | 291-298 | 8 | 6 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 5 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 5 |
| α-helix | 368-380 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 7 |
| β-strand | 15-16 | 2 | 8 |
| β-strand | 17-22 | 6 | 7 |
| β-strand | 25-28 | 4 | 7 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 8 |
| β-strand | 42-44 | 3 | 9 |
| β-strand | 49-51 | 3 | 9 |
| α-helix | 53-57 | 5 | |
| α-helix | 59-61 | 3 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 9 |
| α-helix | 70-73 | 4 | |
| α-helix | 81-86 | 6 | |
| α-helix | 87-89 | 3 | |
| β-strand | 93-97 | 5 | 10 |
| β-strand | 100-107 | 8 | 10 |
| β-strand | 110-114 | 5 | 10 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 7 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 7 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-200 | 8 | 11 |
| β-strand | 205-213 | 9 | 11 |
| β-strand | 216-225 | 10 | 11 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-274 | 18 | |
| β-strand | 279-288 | 10 | 12 |
| β-strand | 291-298 | 8 | 12 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 11 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| β-strand | 360 | 1 | 11 |
| α-helix | 368-381 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock cognate 71 kDa protein | A, B | protein | 383 | Homo sapiens | P11142 (AlphaFold model) |
>4H5R_1 Heat shock cognate 71 kDa protein (chains A, B) SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS MVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI AYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF IAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRAR FEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNK SINPDEAVAYGAAVQAAILSGDK
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 7 |
Water and common crystallization additives (NA, CL, SO4, GOL) are not listed.
New crystal structures of HSC-70 ATP binding domain confirm the role of individual binding pockets and suggest a new method of inhibition. Zhang, Z., Cellitti, J., Teriete, P. et al. Biochimie (2015) 108:186-192. DOI 10.1016/j.biochi.2014.11.012 · PubMed
Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4H5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.