6ZYJ: Hsc70 ATPase domain

Crystal structure of Hsc70 ATPase domain in complex with ADP and calcium. Determined by X-ray diffraction at 1.85 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,399
Mol. weight: 85.01 kDa
Ligands: ADP, CA
Released: 16 Dec 2020

Explore 6ZYJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZYJ contains 38 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-22	8	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	1
β-strand	42-44	3	2
β-strand	49-51	3	2
α-helix	53-57	5
α-helix	63-65	3
β-strand	66-67	2	2
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	3
β-strand	100-107	8	3
β-strand	110-114	5	3
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
β-strand	193-200	8	4
β-strand	205-213	9	4
β-strand	216-225	10	4
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	5
β-strand	291-298	8	5
α-helix	299-305	7
α-helix	307-311	5
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	4
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	4
α-helix	368-381	14

Chain B: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	6
β-strand	15-22	8	6
β-strand	25-28	4	6
α-helix	29-30	2
β-strand	38-39	2	6
β-strand	42-44	3	7
β-strand	49-51	3	7
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	7
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	8
β-strand	100-107	8	8
β-strand	110-114	5	8
α-helix	116-135	20
β-strand	141-146	6	6
α-helix	152-164	13
β-strand	168-174	7	6
α-helix	175-182	8
β-strand	193-200	8	9
β-strand	205-213	9	9
β-strand	216-225	10	9
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	10
β-strand	291-298	8	10
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-323	10
α-helix	328-330	3
β-strand	333-337	5	9
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	9
α-helix	368-380	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock cognate 71 kDa protein	A, B	protein	380	Homo sapiens	P11142 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6ZYJ_1 Heat shock cognate 71 kDa protein (chains A, B)
PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPT
NTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL
TKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG
LDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAE
FKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEE
LNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSIN
PDEAVAYGAAVQAAILSGDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL, ACT) are not listed.

Primary citation

Calcium depletion challenges endoplasmic reticulum proteostasis by destabilising BiP-substrate complexes. Preissler, S., Rato, C., Yan, Y. et al. Elife (2020) 9. DOI 10.7554/eLife.62601 · PubMed

Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AQM 1.63 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5R 1.64 Å, HSC70 NBD with Na, Cl and glycerol
5AQL 1.69 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5V 1.75 Å, HSC70 NBD with Mg
5AQV 1.75 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
6B1N 1.8 Å, Disrupted hydrogen bond network impairs ATPase activity in an Hsc70 cysteine mutant
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4H5N 1.86 Å, HSC70 NBD with PO4, Na, Cl
5AQF 1.88 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3LDQ 1.9 Å, Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
4H5T 1.9 Å, HSC70 NBD with ADP and Mg
5AQT 1.9 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…

Browse structure collections

About this viewer

MolViewer shows 6ZYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.