Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site residues. Determined by X-ray diffraction at 1.69 Å resolution. Released 5 Oct 2016.
Explore 5AQL in 3D Show helices and sheets RCSB PDB PDBe
5AQL contains 45 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 1 |
| β-strand | 7-10 | 4 | 2 |
| β-strand | 15-16 | 2 | 3 |
| β-strand | 17-22 | 6 | 2 |
| β-strand | 25-28 | 4 | 2 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 3 |
| β-strand | 42-44 | 3 | 4 |
| β-strand | 49-51 | 3 | 4 |
| α-helix | 53-57 | 5 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 4 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 5 |
| β-strand | 100-107 | 8 | 5 |
| β-strand | 110-114 | 5 | 5 |
| α-helix | 116-135 | 20 | |
| β-strand | 138 | 1 | 1 |
| β-strand | 141-146 | 6 | 2 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 2 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-201 | 9 | 6 |
| β-strand | 204-213 | 10 | 6 |
| β-strand | 216-225 | 10 | 6 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 7 |
| β-strand | 291-298 | 8 | 7 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-324 | 11 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 6 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 6 |
| α-helix | 368-380 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 153-188 | 36 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204-221 | 18 | |
| α-helix | 231-257 | 27 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 8 |
| β-strand | 7-10 | 4 | 9 |
| β-strand | 15-16 | 2 | 10 |
| β-strand | 17-22 | 6 | 9 |
| β-strand | 25-28 | 4 | 9 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 10 |
| β-strand | 42-44 | 3 | 11 |
| β-strand | 49-51 | 3 | 11 |
| α-helix | 53-56 | 4 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 11 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 12 |
| β-strand | 100-107 | 8 | 12 |
| β-strand | 110-114 | 5 | 12 |
| α-helix | 116-135 | 20 | |
| β-strand | 138 | 1 | 8 |
| β-strand | 141-146 | 6 | 9 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 9 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-201 | 9 | 13 |
| β-strand | 204-213 | 10 | 13 |
| β-strand | 216-225 | 10 | 13 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 14 |
| β-strand | 291-298 | 8 | 14 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 13 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| β-strand | 360 | 1 | 13 |
| α-helix | 368-380 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock cognate 71 kda protein | A, C | protein | 386 | HOMO SAPIENS | P11142 (AlphaFold model) |
| Bag family molecular chaperone regulator 1 | B, D | protein | 118 | HOMO SAPIENS | Q99933 (AlphaFold model) |
>5AQL_1 HEAT SHOCK COGNATE 71 KDA PROTEIN (chains A, C) GPLGSMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA KNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE PTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDN RMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLWSSTQASIEIDSLYEGIDFYT SITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFN GKELNKSINPDEAVAYGAAVQAAILS
>5AQL_2 BAG FAMILY MOLECULAR CHAPERONE REGULATOR 1 (chains B, D) GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDR RVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETE
A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms. Jones, A.M., Westwood, I.M., Osborne, J.D. et al. Sci Rep (2016) 6:34701-34701. DOI 10.1038/srep34701 · PubMed
Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5AQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.