6B1N: Heat shock protein family A member 8

Disrupted hydrogen bond network impairs ATPase activity in an Hsc70 cysteine mutant. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo Sapiens
Chains: 2
Atoms: 6,762
Mol. weight: 89.82 kDa
Ligands: ADP, MG
Released: 17 Jan 2018

Explore 6B1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B1N contains 39 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	15-16	2	2
β-strand	17-22	6	1
β-strand	25-28	4	1
β-strand	38-39	2	2
β-strand	42-44	3	3
β-strand	49-51	3	3
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	3
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	4
β-strand	100-107	8	4
β-strand	110-114	5	4
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
α-helix	185-187	3
β-strand	193-200	8	5
β-strand	205-213	9	5
β-strand	216-225	10	5
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	6
β-strand	291-298	8	6
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-323	10
α-helix	328-330	3
β-strand	333-337	5	5
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	5
α-helix	365-367	3
α-helix	368-380	13

Chain B: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	7
β-strand	15-16	2	8
β-strand	17-22	6	7
β-strand	25-28	4	7
β-strand	38-39	2	8
β-strand	41-44	4	9
β-strand	49-51	3	9
α-helix	53-57	5
α-helix	59-61	3
α-helix	63-65	3
β-strand	66-68	3	9
α-helix	70-73	4
α-helix	81-87	7
β-strand	93-97	5	10
β-strand	100-107	8	10
β-strand	110-114	5	10
α-helix	116-135	20
β-strand	141-146	6	7
α-helix	152-164	13
β-strand	168-174	7	7
α-helix	175-182	8
β-strand	193-200	8	11
β-strand	205-213	9	11
β-strand	216-225	10	11
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	12
β-strand	291-298	8	12
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-323	10
α-helix	328-330	3
β-strand	333-337	5	11
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	11
α-helix	365-367	3
α-helix	368-380	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein family A (Hsp70) member 8	A, B	protein	400	Homo Sapiens	P11142 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6B1N_1 Heat shock protein family A (Hsp70) member 8 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASPAVGIDLGTTYSWVGVFQHGKVEIIANDQGNRTTPSY
VAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRP
KVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDA
GTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKS
TAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQAS
IEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGST
RIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILS

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Disrupted Hydrogen-Bond Network and Impaired ATPase Activity in an Hsc70 Cysteine Mutant. O'Donnell, J.P., Marsh, H.M., Sondermann, H. et al. Biochemistry (2018) 57:1073-1086. DOI 10.1021/acs.biochem.7b01005 · PubMed

Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AQM 1.63 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5R 1.64 Å, HSC70 NBD with Na, Cl and glycerol
5AQL 1.69 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5V 1.75 Å, HSC70 NBD with Mg
5AQV 1.75 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
6ZYJ 1.85 Å, Crystal structure of Hsc70 ATPase domain in complex with ADP and calcium
4H5N 1.86 Å, HSC70 NBD with PO4, Na, Cl
5AQF 1.88 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3LDQ 1.9 Å, Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
4H5T 1.9 Å, HSC70 NBD with ADP and Mg
5AQT 1.9 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…

Browse structure collections

About this viewer

MolViewer shows 6B1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.