The Structure of V122I Mutant Transthyretin in Complex with Tafamidis. Determined by X-ray diffraction at 1.2 Å resolution. Released 5 Jun 2013.
Explore 4HIS in 3D Show helices and sheets RCSB PDB PDBe
4HIS contains 2 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-18 | 7 | 1 |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 29-35 | 7 | 2 |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 54-55 | 2 | 1 |
| β-strand | 67-73 | 7 | 2 |
| α-helix | 75-81 | 7 | |
| β-strand | 88-97 | 10 | 2 |
| β-strand | 99 | 1 | 3 |
| β-strand | 101 | 1 | 3 |
| β-strand | 104-112 | 9 | 1 |
| β-strand | 115-123 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-18 | 7 | 1 |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 29-35 | 7 | 2 |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 54-55 | 2 | 1 |
| β-strand | 67-73 | 7 | 2 |
| α-helix | 75-81 | 7 | |
| β-strand | 88-97 | 10 | 2 |
| β-strand | 104-112 | 9 | 1 |
| β-strand | 115-123 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transthyretin | A, B | protein | 127 | Homo sapiens | P02766 (AlphaFold model) |
>4HIS_1 Transthyretin (chains A, B) GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA VITNPKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 3MI | 2-(3,5-dichlorophenyl)-1,3-benzoxazole-6-carboxylic acid | C14 H7 Cl2 N O3 | 1 |
AG10 inhibits amyloidogenesis and cellular toxicity of the familial amyloid cardiomyopathy-associated V122I transthyretin. Penchala, S.C., Connelly, S., Wang, Y. et al. Proc Natl Acad Sci U S A (2013) 110:9992-9997. DOI 10.1073/pnas.1300761110 · PubMed
Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HIS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.