4HJ5: Schizosaccharomyces pombe Pot1pC

Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT). Determined by X-ray diffraction at 2.04 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Schizosaccharomyces pombe
Chains: 2
Atoms: 1,444
Mol. weight: 19.96 kDa
Released: 12 Dec 2012

Explore 4HJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HJ5 contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	16-28	13	1
β-strand	33-38	6	1
β-strand	49	1	2
β-strand	63	1	2
β-strand	67-71	5	1
α-helix	73-79	7
β-strand	88-98	11	1
β-strand	104-108	5	1
α-helix	114-116	3
β-strand	119-123	5	1
α-helix	128-130	3
α-helix	131-137	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A	protein	143	Schizosaccharomyces pombe	O13988 (AlphaFold model)
DNA (5'-d(gpgptptptpcpgpgp*t)-3')	B	DNA	9	Schizosaccharomyces pombe

Sequence of entity 1 (A), FASTA

>4HJ5_1 Protection of telomeres protein 1 (chains A)
MSDSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRG
PFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSI
EKVDSEEPELNEIKSRKRLYVQN

Sequence of entity 2 (B), FASTA

>4HJ5_2 DNA (5'-D(*GP*GP*TP*TP*TP*CP*GP*GP*T)-3') (chains B)
GGTTTCGGT

Primary citation

Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes. Dickey, T.H., McKercher, M.A., Wuttke, D.S. Structure (2013) 21:121-132. DOI 10.1016/j.str.2012.10.015 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
1QZG 1.9 Å, Crystal structure of Pot1 (protection of telomere)- ssDNA complex
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
5USO 2.0 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)
4HJA 2.1 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (ACGGTTACGGT)

Browse structure collections

About this viewer

MolViewer shows 4HJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.