Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera (rGGTTACGGT). Determined by X-ray diffraction at 1.61 Å resolution. Released 18 Apr 2018.
Explore 5USB in 3D Show helices and sheets RCSB PDB PDBe
5USB contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-10 | 3 | |
| β-strand | 16-28 | 13 | 1 |
| β-strand | 33-38 | 6 | 1 |
| β-strand | 49 | 1 | 2 |
| β-strand | 63 | 1 | 2 |
| β-strand | 67-71 | 5 | 1 |
| α-helix | 74-79 | 6 | |
| β-strand | 88-98 | 11 | 1 |
| β-strand | 104-108 | 5 | 1 |
| β-strand | 119-123 | 5 | 1 |
| α-helix | 128-130 | 3 | |
| α-helix | 131-140 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protection of telomeres protein 1 | A | protein | 139 | Schizosaccharomyces pombe | O13988 (AlphaFold model) |
| G1R_9mer dna/rna (5'-r(*g)-d(p*gp*tp*tp*ap*cp*gp*gp*t)-3') | B | NA-hybrid | 9 | Schizosaccharomyces pombe |
>5USB_1 Protection of telomeres protein 1 (chains A) DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPF GRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEK VDSEEPELNEIKSRKRLYV
>5USB_2 G1R_9mer DNA/RNA (5'-R(*G)-D(P*GP*TP*TP*AP*CP*GP*GP*T)-3') (chains B) GGTTACGGT
Discrimination against RNA Backbones by a ssDNA Binding Protein. Lloyd, N.R., Wuttke, D.S. Structure (2018) 26:722-733.e2. DOI 10.1016/j.str.2018.03.016 · PubMed
Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5USB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.