4HJJ: Interleukin-18

Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,248
Mol. weight: 91.91 kDa
Released: 8 May 2013

Explore 4HJJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HJJ contains 27 α-helices and 82 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	38-42	5	1
β-strand	45-49	5	1
α-helix	54	1
β-strand	55-58	4	1
β-strand	64-67	4	1
α-helix	71-76	6
β-strand	83-90	8	1
β-strand	96-103	8	1
β-strand	107-111	5	1
α-helix	113-115	3
β-strand	118-121	4	1
α-helix	123-125	3
β-strand	127-128	2	1
β-strand	137-141	5	1
α-helix	142	1
β-strand	149-153	5	1
β-strand	159-166	8	1
β-strand	169-176	8	1
α-helix	183-185	3
β-strand	187-191	5	1

Chain H: 10 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	11-12	2	3
β-strand	18-25	8	2
β-strand	35-41	7	4
β-strand	48-54	7	4
β-strand	58-61	4	4
α-helix	66-68	3
β-strand	69-73	5	2
β-strand	79-84	6	2
α-helix	89-91	3
β-strand	93-100	8	4
β-strand	106-109	4	4
β-strand	113-115	3	4
β-strand	116-117	2	3
β-strand	128-131	4	5
α-helix	132-134	3
β-strand	135-137	3	6
β-strand	143-150	8	5
α-helix	154-156	3
β-strand	159-164	6	6
β-strand	170-177	8	6
β-strand	182-185	4	6
β-strand	190	1	7
β-strand	193	1	7
β-strand	194-198	5	5
β-strand	203-208	6	5
α-helix	213-215	3
β-strand	217-224	8	6
α-helix	225	1
β-strand	233-236	4	6
β-strand	240-244	5	6
β-strand	250	1	8
α-helix	251-252	2
β-strand	253-257	5	9
β-strand	269-279	11	9
β-strand	280	1	8
β-strand	285-288	4	10
α-helix	289-291	3
β-strand	293	1	10
β-strand	297-299	3	9
α-helix	300-302	3
β-strand	303-304	2	9
β-strand	310-319	10	9
β-strand	329-334	6	10
α-helix	335-337	3
β-strand	339-344	6	10

Chain L: 11 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-13	4	4
β-strand	19-25	7	11
β-strand	33-38	6	4
β-strand	45-49	5	4
β-strand	53-54	2	4
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
α-helix	80-82	3
β-strand	84-90	7	4
α-helix	96	1
β-strand	97-98	2	4
β-strand	102-106	5	4
α-helix	107-116	10
β-strand	117-120	4	12
β-strand	123-126	4	13
β-strand	132-138	7	12
β-strand	146-151	6	13
β-strand	158-162	5	13
β-strand	166-167	2	13
β-strand	175-180	6	12
β-strand	183-188	6	12
α-helix	193-195	3
β-strand	198-206	9	13
β-strand	209-212	4	13
β-strand	216-220	5	13
β-strand	225	1	14
α-helix	226-227	2
β-strand	228-232	5	15
α-helix	233-235	3
α-helix	236-239	4
β-strand	243-253	11	15
β-strand	254	1	14
β-strand	258-264	7	16
β-strand	267-268	2	16
α-helix	269	1
β-strand	273-277	5	15
α-helix	278-281	4
β-strand	287-296	10	15
α-helix	297-301	5
β-strand	305-312	8	16
β-strand	319-324	6	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A	protein	157	Homo sapiens	Q14116 (AlphaFold model)
Anti-IL12 Anti-IL18 DFab Heavy Chain	H	protein	348	Homo sapiens
Anti-IL12 Anti-IL18 DFab Light Chain	L	protein	327	Homo sapiens

Sequence of entity 1 (A), FASTA

>4HJJ_1 Interleukin-18 (chains A)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDARDNAPRTIFIISMYKDSQPRGM
AVTISVKAEKISTLSAENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLAAEKERDLFKLILKKEDELGDRSIMFTVQNEA

Sequence of entity 2 (H), FASTA

>4HJJ_2 Anti-IL12 Anti-IL18 DFab Heavy Chain (chains H)
EVTLRESGPALVKPTQTLTLTCTFSGFSLSKSVMGVSWIRQPPGKALEWLAHIYWDDDKY
YNPSLSARLTISKDTSKNQVVLTMTNMDPVDTATYYCARRGIRSAMDYWGQGTTVTVSSA
STKGPEVQLVQSGTEVKKPGESLKISCKGSGYTVTSYWIGWVRQMPGKGLEWMGFIYPGD
SETRYSPTFQGQVTISADKSFNTAFLQWSSLKASDTAMYYCARVGSGWYPYTFDIWGQGT
MVTVSSASTKGPSVFPLAPSSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Sequence of entity 3 (L), FASTA

>4HJJ_3 Anti-IL12 Anti-IL18 DFab Light Chain (chains L)
DIVMTQSPDSLAVSLGERATINCKASQSVSNDVAWYQQKPGQPPKLLIYYASNRYTGVPD
RFSGSGSGTDFTLTISSLEAEDVAVYYCQQDYNSPWTFGGGTKVEIKRTVAAPEIVMTQS
PATLSVSPGERATLSCRASESISSNLAWYQQKPGQAPRLFIYTASTRATDIPARFSGSGS
GTEFTLTISSLQSEDFAVYYCQQYNNWPSITFGQGTRLEIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY
EKHKVYACEVTHQGLSSPVTKSFNRGE

Primary citation

Structure reveals function of the dual variable domain immunoglobulin (DVD-Ig[TM]) molecule. Jakob, C.G., Edalji, R., Judge, R.A. et al. MAbs (2013) 5:358-363. DOI 10.4161/mabs.23977 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
9OD9 1.6 Å, Structure of disulfide-stabilized IL-18 variant
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4XFT 2.0 Å, Structure of IL-18 SER Mutant III
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex
4XFU 2.85 Å, Structure of IL-18 SER Mutant V

Browse structure collections

About this viewer

MolViewer shows 4HJJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.