4HQP: Alpha7 nicotinic receptor chimera

Alpha7 nicotinic receptor chimera and its complex with Alpha bungarotoxin. Determined by X-ray diffraction at 3.51 Å resolution. Released 17 Jul 2013.

Method: X-ray diffraction
Resolution: 3.51 Å
Organisms: Homo sapiens, Lymnaea stagnalis, Bungarus multicinctus
Chains: 10
Atoms: 11,092
Mol. weight: 158.46 kDa
Ligands: NAG
Released: 17 Jul 2013

Explore 4HQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HQP contains 21 α-helices and 114 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	22	1	1
β-strand	25	1	1
β-strand	27-42	16	2
β-strand	47-59	13	2
β-strand	75-79	5	2
β-strand	89-90	2	3
β-strand	93	1	2
β-strand	98-99	2	2
β-strand	104-108	5	2
β-strand	112-115	4	2
β-strand	118-124	7	2
α-helix	128-130	3
β-strand	136-143	8	3
β-strand	152-156	5	2
α-helix	161-163	3
β-strand	170-180	11	3
β-strand	183-184	2	4
β-strand	186	1	4
β-strand	193-202	10	3

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	27-42	16	5
β-strand	47-59	13	5
β-strand	75-79	5	5
β-strand	89-90	2	6
β-strand	93	1	5
β-strand	98-99	2	5
β-strand	104-108	5	5
β-strand	112-115	4	5
β-strand	118-124	7	5
α-helix	128-130	3
β-strand	136-143	8	6
β-strand	152-155	4	5
β-strand	160	1	5
β-strand	170-180	11	6
β-strand	183-184	2	7
β-strand	186	1	7
β-strand	193-202	10	6

Chain C: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	27-42	16	8
β-strand	47-59	13	8
β-strand	75-79	5	8
β-strand	88-90	3	9
β-strand	93	1	8
β-strand	98-99	2	8
β-strand	104-108	5	8
β-strand	112-115	4	8
β-strand	118-124	7	8
α-helix	128-130	3
β-strand	136-144	9	9
β-strand	152-155	4	8
β-strand	170-180	11	9
β-strand	184	1	10
β-strand	193-202	10	9

Chain D: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	27-42	16	11
β-strand	47-59	13	11
β-strand	75-79	5	11
β-strand	88-90	3	12
β-strand	93	1	11
β-strand	98-99	2	11
β-strand	104-108	5	11
β-strand	112-115	4	11
β-strand	118-124	7	11
α-helix	128-130	3
β-strand	136-144	9	12
β-strand	152-155	4	11
β-strand	170-180	11	12
β-strand	183-184	2	13
β-strand	186	1	13
β-strand	193-202	10	12

Chain E: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	27-42	16	14
β-strand	47-59	13	14
β-strand	75-79	5	14
β-strand	88-90	3	15
β-strand	93	1	14
β-strand	98-99	2	14
β-strand	104-108	5	14
β-strand	112-115	4	14
β-strand	118-124	7	14
α-helix	128-130	3
β-strand	136-144	9	15
β-strand	152-156	5	14
β-strand	170-180	11	15
β-strand	184	1	16
β-strand	186	1	16
β-strand	193-202	10	15

Chains F and J: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	17
β-strand	5	1	18
β-strand	12	1	18
β-strand	15	1	17
β-strand	22-27	6	19
α-helix	32-34	3
β-strand	39	1	10
β-strand	40-45	6	19
α-helix	48-52	5
β-strand	59-60	2	19

Chains G, H and I: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	20
β-strand	5	1	21
β-strand	12	1	21
β-strand	15	1	20
β-strand	22-27	6	7
α-helix	32-34	3
β-strand	39-45	7	7
α-helix	48-52	5
β-strand	59-60	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha7 nicotinic receptor chimera	A, B, C, D, E	protein	202	Homo sapiens, Lymnaea stagnalis	P58154 (AlphaFold model)
Alpha-bungarotoxin isoform V31	F, G, H, I, J	protein	73	Bungarus multicinctus	P60616 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>4HQP_1 Alpha7 nicotinic receptor chimera (chains A, B, C, D, E)
QRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHY
LQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQR
FSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSER
FYECCKEPYPDVTFTVTFRKKG

Sequence of entity 2 (F, G, H, I, J), FASTA

>4HQP_2 Alpha-bungarotoxin isoform V31 (chains F, G, H, I, J)
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors. Li, S.X., Cheng, K., Gomoto, R. et al. To be published.

Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
4ZK1 1.75 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in…
4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
8P11 1.9 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
5J5F 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…

Browse structure collections

About this viewer

MolViewer shows 4HQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.