4HXJ: SH3:RGT complex

Crystal structure of SH3:RGT complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Nov 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,040
Mol. weight: 13.78 kDa
Released: 28 Nov 2012

Explore 4HXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HXJ contains 2 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	85-88	4	1
β-strand	92	1	2
β-strand	99	1	1
β-strand	102	1	2
β-strand	107-109	3	1
β-strand	118-123	6	1
β-strand	129-133	5	1
α-helix	134-136	3
β-strand	137-139	3	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	3
β-strand	92	1	4
β-strand	99	1	3
β-strand	102	1	4
β-strand	107-112	6	3
β-strand	118-123	6	3
β-strand	129-133	5	3
α-helix	134-136	3
β-strand	137-139	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase Src	A, B	protein	60	Homo sapiens	P12931 (AlphaFold model)
C-terminal 3-mer peptide from Integrin beta-3	C	protein	3	Homo sapiens	P05106 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4HXJ_1 Proto-oncogene tyrosine-protein kinase Src (chains A, B)
GSTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD

Sequence of entity 2 (C), FASTA

>4HXJ_2 C-terminal 3-mer peptide from Integrin beta-3 (chains C)
RGT

Primary citation

Structural framework of c-Src activation by integrin beta 3. Xiao, R., Xi, X.D., Chen, Z. et al. Blood (2013) 121:700-706. DOI 10.1182/blood-2012-07-440644 · PubMed

Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFX 1.45 Å, Crystal structure of c-Src SH3 domain in H32 space group mediated by nickel
1FMK 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src
1O43 1.5 Å, Crystal structure of SH2 in complex with RU82129.
1O4A 1.5 Å, Crystal structure of SH2 in complex with RU82197.
1O4R 1.5 Å, Crystal structure of SH2 in complex with RU78783.
2SRC 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp
6C4S 1.5 Å, Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69
7NG7 1.5 Å, Src kinase bound to eCF506 trapped in inactive conformation
8VCF 1.5 Å, Crystal structure of Superbinder Src SH2 domain with Cysteine to Serine mutations
1O48 1.55 Å, Crystal structure of SH2 in complex with RU85053.
1O4G 1.55 Å, Crystal structure of SH2 in complex with DPI59.
1O4K 1.57 Å, Crystal structure of SH2 in complex with pasbn.

Browse structure collections

About this viewer

MolViewer shows 4HXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.