4IFF: PDB entry 4IFF

Structural organization of FtsB, a transmembrane protein of the bacterial divisome. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Bacillus phage phi29, Escherichia coli
Chains: 4
Atoms: 2,789
Mol. weight: 38.74 kDa
Released: 10 Apr 2013

Explore 4IFF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IFF contains 13 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-16	12
α-helix	22-159	59

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-14	10
α-helix	22-155	55

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-14	10
α-helix	22-157	57

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-14	10
α-helix	22-133	33
α-helix	136-158	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion of phage phi29 Gp7 protein and Cell division protein FtsB	A, B, C, D	protein	86	Bacillus phage phi29, Escherichia coli	P0A6S5 (AlphaFold model), P13848

Sequence of entity 1 (A, B, C, D), FASTA

>4IFF_1 Fusion of phage phi29 Gp7 protein and Cell division protein FtsB (chains A, B, C, D)
GSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKDYTRVNDDVA
AQQATNAKLKARNDQLFAEIDDLNGG

Primary citation

Structural Organization of FtsB, a Transmembrane Protein of the Bacterial Divisome. Lapointe, L.M., Taylor, K.C., Subramaniam, S. et al. Biochemistry (2013) 52:2574-2585. DOI 10.1021/bi400222r · PubMed

Other PDB entries of the same protein (UniProt P0A6S5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9N 2.6 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
6H9O 2.8 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
5Z2W 3.0 Å, Crystal structure of the bacterial cell division protein FtsQ and FtsB
8HHF 3.04 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8HHG 3.1 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8HHH 3.3 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ

Browse structure collections

About this viewer

MolViewer shows 4IFF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.