8HHG: Cell division protein FtsQ

Name: PDB 8HHG: The bacterial divisome protein complex FtsB-FtsL-FtsQ
Published: 2023-04-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

The bacterial divisome protein complex FtsB-FtsL-FtsQ. Determined by X-ray diffraction at 3.1 Å resolution. Released 26 Apr 2023.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Escherichia coli K-12
Chains: 3
Atoms: 3,281
Mol. weight: 58.57 kDa
Released: 26 Apr 2023

Explore 8HHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HHG contains 12 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-20	18
α-helix	26-60	35
α-helix	65-73	9
β-strand	78	1	3
β-strand	83-88	6	2

Chain L: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-91	51
α-helix	94-103	10
β-strand	107	1	3
β-strand	114-118	5	2

Chain Q: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	23-50	28
β-strand	60-63	4	1
α-helix	71-78	8
α-helix	79-81	3
α-helix	92-102	11
β-strand	106-112	7	1
β-strand	119-125	7	1
β-strand	130-132	3	2
β-strand	136-138	3	2
β-strand	144-146	3	2
α-helix	149-151	3
β-strand	159-161	3	2
α-helix	167-183	17
β-strand	188-193	6	2
β-strand	199-203	5	2
β-strand	208-210	3	2
α-helix	216-236	21
β-strand	240-245	6	2
β-strand	251-257	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein FtsQ	Q	protein	276	Escherichia coli K-12	P06136 (AlphaFold model)
Cell division protein FtsB	B	protein	119	Escherichia coli K-12	P0A6S5 (AlphaFold model)
Cell division protein FtsL	L	protein	121	Escherichia coli K-12	P0AEN4 (AlphaFold model)

Sequence of entity 1 (Q), FASTA

>8HHG_1 Cell division protein FtsQ (chains Q)
MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKL
VLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELK
IHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQM
LAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKR
ISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ

Sequence of entity 2 (B), FASTA

>8HHG_2 Cell division protein FtsB (chains B)
MGSSHHHHHHSQDPNSMGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNA
KLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR

Sequence of entity 3 (L), FASTA

>8HHG_3 Cell division protein FtsL (chains L)
MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHT
RLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
K

Primary citation

Structure of the heterotrimeric membrane protein complex FtsB-FtsL-FtsQ of the bacterial divisome. Nguyen, H.T.V., Chen, X., Parada, C. et al. Nat Commun (2023) 14:1903-1903. DOI 10.1038/s41467-023-37543-4 · PubMed

Other PDB entries of the same protein (UniProt P06136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9N 2.6 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
2VH1 2.7 Å, Crystal structure of bacterial cell division protein FtsQ from E.coli
6H9O 2.8 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
5Z2W 3.0 Å, Crystal structure of the bacterial cell division protein FtsQ and FtsB
8HHF 3.04 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
8HHH 3.3 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA2 3.84 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+20C)
4UE4 7.0 Å, Structural basis for targeting and elongation arrest of Bacillus signal recognition…

Browse structure collections

About this viewer

MolViewer shows 8HHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.