6H9O: Cell division protein FtsQ

Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB. Determined by X-ray diffraction at 2.8 Å resolution. Released 5 Sept 2018.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Escherichia coli, Escherichia coli S88
Chains: 4
Atoms: 3,574
Mol. weight: 58.31 kDa
Released: 5 Sept 2018

Explore 6H9O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H9O contains 14 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	59-64	6	1
α-helix	71-80	10
α-helix	92-102	11
β-strand	106-114	9	1
β-strand	118-125	8	1
β-strand	128-132	5	2
β-strand	136-139	4	2
β-strand	144-146	3	2
α-helix	149-151	3
α-helix	158	1
β-strand	159-161	3	2
α-helix	167-182	16
β-strand	188-193	6	2
β-strand	199-203	5	2
β-strand	208-212	5	2
α-helix	216-236	21
β-strand	239-245	7	2
β-strand	251-258	8	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	65-73	9
β-strand	82-86	5	2

Chain C: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	59-63	5	3
α-helix	71-79	9
α-helix	92-102	11
β-strand	106-114	9	3
β-strand	118-125	8	3
β-strand	128-132	5	4
β-strand	136-139	4	4
β-strand	144-145	2	4
α-helix	149-152	4
α-helix	158	1
β-strand	159-161	3	4
α-helix	167-182	16
β-strand	188-193	6	4
β-strand	199-203	5	4
β-strand	208-212	5	4
α-helix	216-236	21
β-strand	240-245	6	4
β-strand	251-257	7	4

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	66-74	9
β-strand	82-86	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein FtsQ	A, C	protein	228	Escherichia coli	P06136 (AlphaFold model)
Cell division protein FtsB	B, D	protein	24	Escherichia coli S88	P0A6S5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6H9O_1 Cell division protein FtsQ (chains A, C)
MSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWP
DELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYRE
MGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQT
DGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQGSHHHHHH

Sequence of entity 2 (B, D), FASTA

>6H9O_2 Cell division protein FtsB (chains B, D)
QEALEERARNELSLTRPGETFYRL

Primary citation

Structural Analysis of the Interaction between the Bacterial Cell Division Proteins FtsQ and FtsB. Kureisaite-Ciziene, D., Varadajan, A., McLaughlin, S.H. et al. mBio (2018) 9. DOI 10.1128/mBio.01346-18 · PubMed

Other PDB entries of the same protein (UniProt P06136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9N 2.6 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
2VH1 2.7 Å, Crystal structure of bacterial cell division protein FtsQ from E.coli
5Z2W 3.0 Å, Crystal structure of the bacterial cell division protein FtsQ and FtsB
8HHF 3.04 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8HHG 3.1 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
8HHH 3.3 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA2 3.84 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+20C)
4UE4 7.0 Å, Structural basis for targeting and elongation arrest of Bacillus signal recognition…

Browse structure collections

About this viewer

MolViewer shows 6H9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.