5Z2W: Bacterial cell division protein FtsQ and FtsB

Crystal structure of the bacterial cell division protein FtsQ and FtsB. Determined by X-ray diffraction at 3.0 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,968
Mol. weight: 28.05 kDa
Ligands: MG
Released: 2 Jan 2019

Explore 5Z2W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z2W contains 5 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
α-helix	22-30	9
α-helix	43-53	11
β-strand	57-65	9	1
β-strand	69-76	8	1
β-strand	79-81	3	2
β-strand	82-83	2	3
β-strand	88-90	3	2
β-strand	95-96	2	2
β-strand	110-112	3	3
α-helix	118-133	16
β-strand	139	1	4
β-strand	141-144	4	3
β-strand	150-153	4	3
β-strand	154	1	4
β-strand	159-163	5	3
α-helix	167-186	20
β-strand	191-196	6	3
β-strand	202-208	7	3

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	274-286	13
β-strand	294-297	4	3
β-strand	303	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein FtsQ	A	protein	209	Escherichia coli	P06136 (AlphaFold model)
Cell division protein FtsB	B	protein	35	Escherichia coli	P0A6S5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Z2W_1 Cell division protein FtsQ (chains A)
QRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVR
KQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQ
GYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQ
QAQTDGKRISYVDLRYDSGAAVGWAPLPP

Sequence of entity 2 (B), FASTA

>5Z2W_2 Cell division protein FtsB (chains B)
NGGQEALEERARNELSMTRPGETFYRLVPDASKRA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Structural Insights into the FtsQ/FtsB/FtsL Complex, a Key Component of the Divisome. Choi, Y., Kim, J., Yoon, H.J. et al. Sci Rep (2018) 8:18061-18061. DOI 10.1038/s41598-018-36001-2 · PubMed

Other PDB entries of the same protein (UniProt P06136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9N 2.6 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
2VH1 2.7 Å, Crystal structure of bacterial cell division protein FtsQ from E.coli
6H9O 2.8 Å, Complex of the periplasmic domains of bacterial cell division proteins FtsQ and FtsB
8HHF 3.04 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8HHG 3.1 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
8HHH 3.3 Å, The bacterial divisome protein complex FtsB-FtsL-FtsQ
8YA2 3.84 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+20C)
4UE4 7.0 Å, Structural basis for targeting and elongation arrest of Bacillus signal recognition…

Browse structure collections

About this viewer

MolViewer shows 5Z2W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.