4IIM: Second SH3 Domain of ITSN1

Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 5
Atoms: 1,333
Mol. weight: 20.09 kDa
Released: 23 Jan 2013

Explore 4IIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IIM contains 4 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	916-920	5	1
β-strand	924	1	2
β-strand	931	1	1
β-strand	934	1	2
β-strand	939-945	7	1
β-strand	949-954	6	1
β-strand	957-962	6	1
α-helix	963-965	3
β-strand	966-969	4	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	916-920	5	3
β-strand	924	1	4
β-strand	931	1	3
β-strand	934	1	4
β-strand	939-945	7	3
β-strand	949-954	6	3
β-strand	957-962	6	3
α-helix	963-965	3
β-strand	966-968	3	3

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2005-2008	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intersectin-1	A, B	protein	70	Homo sapiens	Q15811 (AlphaFold model)
peptide ligand	C, D, E	protein	12

Sequence of entity 1 (A, B), FASTA

>4IIM_1 Intersectin-1 (chains A, B)
GAAQPAMAQGALLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPK
SYVKLISAAA

Sequence of entity 2 (C, D, E), FASTA

>4IIM_2 peptide ligand (chains C, D, E)
WRDSSGYVMGPW

Primary citation

Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide. Guan, X., Dong, A., Huang, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q15811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FIA 1.45 Å, Crystal structure of the EH 1 domain from human intersectin-1 protein. Northeast…
6H5T 1.69 Å, Intersectin SH3A short isoform
1KI1 2.3 Å, Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42
5HZI 2.6 Å, Crystal structure of photoinhibitable Intersectin1 containing C450M mutant LOV2 domain
5HZJ 2.6 Å, Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain
3QBV 2.65 Å, Structure of designed orthogonal interaction between CDC42 and nucleotide exchange…
5HZK 3.3 Å, Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain in…
6GBU 3.44 Å, Crystal structure of the second SH3 domain of FCHSD2 (SH3-2) in complex with the fourth…
2KGR Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics…
2KHN NMR solution structure of the EH 1 domain from human intersectin-1 protein. Northeast…

Browse structure collections

About this viewer

MolViewer shows 4IIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.