Crystal Structure of the inactive Matriptase in complex with its inhibitor HAI-1. Determined by X-ray diffraction at 2.29 Å resolution. Released 6 Mar 2013.
Explore 4ISL in 3D Show helices and sheets RCSB PDB PDBe
4ISL contains 15 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 3 |
| β-strand | 20-21 | 2 | 1 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 4 |
| β-strand | 39-46 | 8 | 4 |
| β-strand | 51-54 | 4 | 4 |
| α-helix | 56-58 | 3 | |
| β-strand | 60B | 1 | 5 |
| β-strand | 60E | 1 | 5 |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 4 |
| β-strand | 72 | 1 | 6 |
| β-strand | 81-90 | 10 | 4 |
| β-strand | 104-108 | 5 | 4 |
| α-helix | 111-114 | 4 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 1 |
| α-helix | 123-125 | 3 | |
| β-strand | 135-140 | 6 | 1 |
| β-strand | 154 | 1 | 6 |
| α-helix | 155 | 1 | |
| β-strand | 156-162 | 7 | 1 |
| α-helix | 165-171 | 7 | |
| β-strand | 180-184 | 5 | 1 |
| β-strand | 189 | 1 | 3 |
| α-helix | 197 | 1 | |
| β-strand | 198-202 | 5 | 1 |
| β-strand | 207-215 | 9 | 1 |
| β-strand | 226-230 | 5 | 1 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-242 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 246 | 1 | |
| α-helix | 247-251 | 5 | |
| α-helix | 253-254 | 2 | |
| β-strand | 259 | 1 | 1 |
| β-strand | 263-269 | 7 | 2 |
| β-strand | 274-280 | 7 | 2 |
| β-strand | 290 | 1 | 2 |
| α-helix | 293-300 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kunitz-type protease inhibitor 1 | B | protein | 60 | Homo sapiens | O43278 (AlphaFold model) |
| Suppressor of tumorigenicity 14 protein | A | protein | 241 | Homo sapiens | Q9Y5Y6 (AlphaFold model) |
>4ISL_1 Kunitz-type protease inhibitor 1 (chains B) QTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGVQ
>4ISL_2 Suppressor of tumorigenicity 14 protein (chains A) VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTA FLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPD ASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFL SGGVDSCQGDAGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTG V
| ID | Name | Formula | Copies |
|---|---|---|---|
| GSH | Glutathione | C10 H17 N3 O6 S | 1 |
Water and common crystallization additives (GOL, PGE, PG4) are not listed.
Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1. Zhao, B., Yuan, C., Li, R. et al. J Biol Chem (2013) 288:11155-11164. DOI 10.1074/jbc.M113.454611 · PubMed
Other PDB entries of the same protein (UniProt O43278 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ISL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.