4IX9: Subunit F of V-ATPase from S. cerevisiae

Crystal structure of subunit F of V-ATPase from S. cerevisiae. Determined by X-ray diffraction at 2.33 Å resolution. Released 20 Mar 2013.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 3,358
Mol. weight: 43.99 kDa
Released: 20 Mar 2013

Explore 4IX9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IX9 contains 24 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	1
α-helix	14-22	9
α-helix	27-29	3
β-strand	37-40	4	1
α-helix	47-55	9
α-helix	56-60	5
β-strand	64-69	6	1
α-helix	71-76	6
α-helix	78-83	6
β-strand	86	1	2
β-strand	90-93	4	1

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	3
α-helix	14-22	9
α-helix	27-29	3
β-strand	37-39	3	3
α-helix	47-55	9
α-helix	56-60	5
β-strand	64-69	6	3
α-helix	71-76	6
α-helix	78-83	6
β-strand	90-93	4	3

Chain C: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	4
α-helix	14-22	9
α-helix	27-29	3
β-strand	37-40	4	4
α-helix	47-55	9
α-helix	56-60	5
β-strand	64-69	6	4
α-helix	71-76	6
α-helix	78-82	5
β-strand	90-93	4	4

Chain D: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	5
α-helix	14-22	9
α-helix	27-29	3
β-strand	37-39	3	5
α-helix	47-55	9
α-helix	56-60	5
β-strand	64-69	6	5
α-helix	71-75	5
α-helix	78-82	5
β-strand	86	1	2
β-strand	90-93	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
V-type proton ATPase subunit F	A, B, C, D	protein	94	Saccharomyces cerevisiae	P39111 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4IX9_1 V-type proton ATPase subunit F (chains A, B, C, D)
MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEE
RDDIAILLMNQHIAENIRARVDSFTNAFPAILEI

Primary citation

Crystal and NMR structures give insights into the role and dynamics of subunit F of the eukaryotic V-ATPase from Saccharomyces cerevisiae. Basak, S., Lim, J., Manimekalai, M.S.S. et al. J Biol Chem (2013) 288:11930-11939. DOI 10.1074/jbc.M113.461533 · PubMed

Other PDB entries of the same protein (UniProt P39111 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EAS 2.6 Å, Yeast VO in complex with Vma12-22p
9COP 2.7 Å, Yeast RAVE bound to V-ATPase V1 complex
8EAT 3.1 Å, Yeast VO missing subunits a, e, and f in complex with Vma12-22p
4RND 3.18 Å, Crystal Structure of the subunit DF-assembly of the eukaryotic V-ATPase.
7TMO 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 1
7TMP 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 2
7TMQ 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 3
7TMM 3.5 Å, Complete V1 Complex from Saccharomyces cerevisiae
7TMR 3.5 Å, V-ATPase from Saccharomyces cerevisiae, State 1
9MOY 3.6 Å, Reconstituted yeast V-ATPase bound to Rtc5p
9NN1 3.7 Å, Yeast V1-ATPase bound to Rtc5p
7FDE 3.8 Å, CryoEM Structures of Reconstituted V-ATPase, Oxr1 bound V1

Browse structure collections

About this viewer

MolViewer shows 4IX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.