4J1V: MOB kinase activator 1A

Functional and structural studies of MOBKL1B, a Salvador/Warts/Hippo tumor suppressor pathway, in HCV replication. Determined by X-ray diffraction at 1.95 Å resolution. Released 6 Aug 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, Hepatitis C virus
Chains: 6
Atoms: 3,526
Mol. weight: 52.52 kDa
Ligands: ZN
Released: 6 Aug 2014

Explore 4J1V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J1V contains 26 α-helices and 10 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	47-48	2
α-helix	53-75	23
α-helix	76-78	3
β-strand	88	1	1
β-strand	94	1	1
β-strand	98	1	2
β-strand	107	1	2
α-helix	111-126	16
α-helix	139-141	3
α-helix	144-165	22
α-helix	167-172	6
α-helix	176-193	18
α-helix	198-201	4
α-helix	202-204	3
α-helix	205-211	7

Chains E and F: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	310-312	3
β-strand	313	1	1

Chains G and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	311-313	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB kinase activator 1A	A, C	protein	184	Homo sapiens	Q9H8S9 (AlphaFold model)
NS5A domain II peptide	E, F, G, H	protein	20	Hepatitis C virus	Q99IB8

Sequence of entity 1 (A, C), FASTA

>4J1V_1 MOB kinase activator 1A (chains A, C)
EATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPR
YEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTIL
KRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
SKDR

Sequence of entity 2 (E, F, G, H), FASTA

>4J1V_2 NS5A domain II peptide (chains E, F, G, H)
ALPAWARPDYNPPLVESWRR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Seed Sequence-Matched Controls Reveal Limitations of Small Interfering RNA Knockdown in Functional and Structural Studies of Hepatitis C Virus NS5A-MOBKL1B Interaction. Chung, H.Y., Gu, M., Buehler, E. et al. J Virol (2014) 88:11022-11033. DOI 10.1128/JVI.01582-14 · PubMed

Other PDB entries of the same protein (UniProt Q9H8S9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PI1 2.0 Å, Crystal structure of a human Mob1 protein; toward understanding Mob-regulated cell cycle…
4JIZ 2.1 Å, Human Mob1-phosphopeptide complex
5XQZ 2.1 Å, Structure of the MOB1-NDR2 complex
5BRK 2.3 Å, pMob1-Lats1 complex
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
6MCP 2.5 Å, L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
6MCQ 2.57 Å, L. pneumophila effector kinase LegK7 in complex with human MOB1A
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
5TWF 3.14 Å, Regulation of protein interactions by MOB1 phosphorylation

Browse structure collections

About this viewer

MolViewer shows 4J1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.