Crystal structure of the APOBEC3F Vif binding domain. Determined by X-ray diffraction at 3.1 Å resolution. Released 6 Nov 2013.
Explore 4J4J in 3D Show helices and sheets RCSB PDB PDBe
4J4J contains 21 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -24 | 1 | |
| β-strand | -23 | 1 | 1 |
| α-helix | -22 | 1 | |
| α-helix | -21--14 | 8 | |
| β-strand | -3-226 | 12 | 2 |
| β-strand | 229-241 | 13 | 2 |
| α-helix | 250-261 | 12 | |
| β-strand | 268-275 | 8 | 2 |
| α-helix | 281-292 | 12 | |
| β-strand | 297-303 | 7 | 2 |
| α-helix | 312-323 | 12 | |
| β-strand | 326-330 | 5 | 2 |
| α-helix | 333-342 | 10 | |
| β-strand | 344 | 1 | 1 |
| α-helix | 349-351 | 3 | |
| α-helix | 353-354 | 2 | |
| α-helix | 357-372 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -24 | 1 | |
| β-strand | -23 | 1 | 3 |
| α-helix | -22 | 1 | |
| α-helix | -21--14 | 8 | |
| β-strand | -3-224 | 10 | 4 |
| β-strand | 226 | 1 | 5 |
| β-strand | 229 | 1 | 5 |
| β-strand | 233-241 | 9 | 4 |
| β-strand | 249 | 1 | 4 |
| α-helix | 250-261 | 12 | |
| β-strand | 269-277 | 9 | 4 |
| α-helix | 278-280 | 3 | |
| α-helix | 281-292 | 12 | |
| β-strand | 297-305 | 9 | 4 |
| α-helix | 312-322 | 11 | |
| β-strand | 326-329 | 4 | 4 |
| α-helix | 333-342 | 10 | |
| β-strand | 344 | 1 | 3 |
| α-helix | 349-351 | 3 | |
| α-helix | 353-354 | 2 | |
| α-helix | 357-372 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA dC->dU-editing enzyme APOBEC-3F | A, B | protein | 209 | Homo sapiens | Q8IUX4 (AlphaFold model) |
>4J4J_1 DNA dC->dU-editing enzyme APOBEC-3F (chains A, B) MAHHHHHHVDDDDKMLVPRGSENLYFQGSAMDPPTFTFNFNNEPWVRGRHETYLCFTMEV VKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECA GEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFV YNDDEPFKPWKGLKYNFLFLDSKLQEILE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural determinants of HIV-1 Vif susceptibility and DNA binding in APOBEC3F. Siu, K.K., Sultana, A., Azimi, F.C. et al. Nat Commun (2013) 4:2593-2593. DOI 10.1038/ncomms3593 · PubMed
Other PDB entries of the same protein (UniProt Q8IUX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4J4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.