4JEH: Munc18a and Syntaxin1 lacking N-peptide complex

Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 17 Jul 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 6,317
Mol. weight: 97.59 kDa
Released: 17 Jul 2013

Explore 4JEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JEH contains 43 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
β-strand	29-33	5	1
α-helix	35-42	8
β-strand	46	1	2
α-helix	47-51	5
β-strand	55-60	6	1
β-strand	72-77	6	1
α-helix	81-89	9
α-helix	94-96	3
β-strand	102-106	5	1
α-helix	112-119	8
α-helix	122-126	5
β-strand	127-132	6	1
β-strand	138-141	4	3
β-strand	144-146	3	3
α-helix	152-157	6
α-helix	159-161	3
α-helix	166-183	18
α-helix	187	1
β-strand	188-191	4	3
α-helix	197-215	19
α-helix	225-227	3
β-strand	229-234	6	3
α-helix	235-237	3
β-strand	248	1	4
α-helix	249-256	8
β-strand	260	1	5
β-strand	263-269	7	5
β-strand	274-280	7	5
α-helix	286-291	6
β-strand	295	1	4
α-helix	296-313	18
α-helix	330-333	4
α-helix	335-337	3
α-helix	338-357	20
α-helix	358-362	5
α-helix	363-374	12
β-strand	376	1	6
α-helix	381	1
β-strand	382	1	6
α-helix	383	1
α-helix	387-395	9
α-helix	401-415	15
β-strand	418	1	7
α-helix	420-430	11
α-helix	434-442	9
α-helix	443-446	4
β-strand	451	1	7
α-helix	462-466	5
α-helix	481-490	10
β-strand	501	1	3
β-strand	536-542	7	3
β-strand	545-546	2	8
α-helix	547-560	14
β-strand	564-569	6	3
β-strand	572-573	2	8
α-helix	575-583	9

Chain B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	31-62	32
α-helix	69-105	37
α-helix	111-155	45
α-helix	162-170	9
α-helix	176-180	5
α-helix	186-211	26
α-helix	213-226	14
α-helix	229-231	3
β-strand	232	1	2
α-helix	233-238	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A	protein	608	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-1A	B	protein	243	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JEH_1 Syntaxin-binding protein 1 (chains A)
MRGSHHHHHHGSVDMAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCK
MTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFF
TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKN
PILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKA
RSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDD
LWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYST
HLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIR
IILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKE
RISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNK
APGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLN
KTDEEISS

Sequence of entity 2 (B), FASTA

>4JEH_2 Syntaxin-1A (chains B)
MDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIK
KTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRE
RCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEII
KLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARR
KKI

Primary citation

Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation. Colbert, K.N., Hattendorf, D.A., Weiss, T.M. et al. Proc Natl Acad Sci U S A (2013) 110:12637-12642. DOI 10.1073/pnas.1303753110 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 4JEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.