Structure of RSK2 T493M CTD mutant bound to 2-cyano-N-(1-hydroxy-2-methylpropan-2-yl)-3-(3-(3,4,5-trimethoxyphenyl)-1H-indazol-5-yl)acrylamide. Determined by X-ray diffraction at 3.1 Å resolution. Released 10 Apr 2013.
Explore 4JG8 in 3D Show helices and sheets RCSB PDB PDBe
4JG8 contains 16 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 422-430 | 9 | 1 |
| β-strand | 434-441 | 8 | 1 |
| β-strand | 446-454 | 9 | 1 |
| α-helix | 461-470 | 10 | |
| β-strand | 476 | 1 | 2 |
| β-strand | 479-484 | 6 | 1 |
| β-strand | 488-493 | 6 | 1 |
| β-strand | 500 | 1 | 2 |
| α-helix | 501-506 | 6 | |
| α-helix | 514-532 | 19 | |
| β-strand | 535-536 | 2 | 3 |
| α-helix | 542-544 | 3 | |
| β-strand | 545-547 | 3 | 2 |
| α-helix | 554-556 | 3 | |
| β-strand | 557-559 | 3 | 2 |
| β-strand | 566-567 | 2 | 3 |
| β-strand | 569 | 1 | 4 |
| β-strand | 575 | 1 | 4 |
| α-helix | 587-613 | 27 | |
| α-helix | 626-635 | 10 | |
| α-helix | 650-659 | 10 | |
| α-helix | 664-666 | 3 | |
| α-helix | 668-669 | 2 | |
| α-helix | 670-674 | 5 | |
| α-helix | 677-680 | 4 | |
| α-helix | 682-684 | 3 | |
| α-helix | 689-690 | 2 | |
| α-helix | 696-710 | 15 | |
| α-helix | 711-713 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S6 kinase alpha-3 | A | protein | 355 | Homo sapiens | P51812 (AlphaFold model) |
>4JG8_1 Ribosomal protein S6 kinase alpha-3 (chains A) AHHHHHHVDDDDKMQTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATN MEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVMELMKGGELLDKI LRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFA KQLRAENGLLMTPCYTANFVAPEVLERQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDT PEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQL PQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1LE | (2S)-2-cyano-N-(1-hydroxy-2-methylpropan-2-yl)-3-[3-(3,4,5-trimethoxyphenyl)-1H… | C24 H28 N4 O5 | 1 |
Electrophilic fragment-based design of reversible covalent kinase inhibitors. Miller, R.M., Paavilainen, V.O., Krishnan, S. et al. J Am Chem Soc (2013) 135:5298-5301. DOI 10.1021/ja401221b · PubMed
Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.