4JIZ: Human Mob1-phosphopeptide complex

Human Mob1-phosphopeptide complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 17 Apr 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,549
Mol. weight: 21.38 kDa
Ligands: ZN
Released: 17 Apr 2013

Explore 4JIZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JIZ contains 10 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
α-helix	32-54	23
α-helix	55-57	3
β-strand	67	1	1
β-strand	72-74	3	1
β-strand	76	1	2
β-strand	86	1	2
α-helix	90-106	17
α-helix	117-120	4
α-helix	123-151	29
α-helix	155-172	18
α-helix	177-180	4
α-helix	181-183	3
α-helix	184-188	5

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-6	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB kinase activator 1A	A	protein	172	Homo sapiens	Q9H8S9 (AlphaFold model)
phosphopeptide	B	protein	8	synthetic construct

Sequence of entity 1 (A), FASTA

>4JIZ_1 MOB kinase activator 1A (chains A)
NLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWAD
GTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVY
AHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL

Sequence of entity 2 (B), FASTA

>4JIZ_2 phosphopeptide (chains B)
YHSVVRYA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Activation of the yeast Hippo pathway by phosphorylation-dependent assembly of signaling complexes. Rock, J.M., Lim, D., Stach, L. et al. Science (2013) 340:871-875. DOI 10.1126/science.1235822 · PubMed

Other PDB entries of the same protein (UniProt Q9H8S9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J1V 1.95 Å, Functional and structural studies of MOBKL1B, a Salvador/Warts/Hippo tumor suppressor…
1PI1 2.0 Å, Crystal structure of a human Mob1 protein; toward understanding Mob-regulated cell cycle…
5XQZ 2.1 Å, Structure of the MOB1-NDR2 complex
5BRK 2.3 Å, pMob1-Lats1 complex
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
6MCP 2.5 Å, L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
6MCQ 2.57 Å, L. pneumophila effector kinase LegK7 in complex with human MOB1A
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
5TWF 3.14 Å, Regulation of protein interactions by MOB1 phosphorylation

Browse structure collections

About this viewer

MolViewer shows 4JIZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.