Crystal structure of the Abl-SH3 domain at pH3. Determined by X-ray diffraction at 1.65 Å resolution. Released 12 Mar 2014.
Explore 4JJB in 3D Show helices and sheets RCSB PDB PDBe
4JJB contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 65-68 | 4 | 1 |
| β-strand | 72 | 1 | 2 |
| β-strand | 79 | 1 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 87-93 | 7 | 1 |
| β-strand | 99-104 | 6 | 1 |
| β-strand | 107-112 | 6 | 1 |
| α-helix | 113-115 | 3 | |
| β-strand | 116-118 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase ABL1 | A | protein | 63 | Homo sapiens | P00519 (AlphaFold model) |
>4JJB_1 Tyrosine-protein kinase ABL1 (chains A) MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITP VNS
Crystal structure of the Abl-SH3 domain at pH3. Camara-Artigas, A., Martin-Garcia, J.M. To be published.
Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JJB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.