4JOI: Human telomeric Stn1-Ten1 complex

Crystal structure of the human telomeric Stn1-Ten1 complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 29 May 2013.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,376
Mol. weight: 65.76 kDa
Released: 29 May 2013

Explore 4JOI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JOI contains 24 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	1
α-helix	31-36	6
α-helix	37	1
β-strand	38-39	2	2
α-helix	40	1
β-strand	47-49	3	2
β-strand	52-54	3	2
β-strand	56-68	13	1
β-strand	72-78	7	1
β-strand	83-89	7	1
α-helix	113-118	6
α-helix	119-122	4
β-strand	131-141	11	1
β-strand	144-155	12	1
α-helix	161-173	13
α-helix	174-178	5

Chain B: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	3
α-helix	31-36	6
α-helix	37	1
β-strand	38-39	2	4
α-helix	40	1
β-strand	47-49	3	4
β-strand	52-54	3	4
β-strand	56-68	13	3
β-strand	72-78	7	3
β-strand	83-89	7	3
α-helix	116-120	5
α-helix	121-123	3
β-strand	131-141	11	3
β-strand	144-155	12	3
α-helix	161-173	13
α-helix	174-178	5
α-helix	181-182	2

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	8-9	2	6
α-helix	12-16	5
β-strand	25-36	12	6
β-strand	41-47	7	6
β-strand	52-58	7	6
β-strand	72-80	9	6
β-strand	88-96	9	6
α-helix	102-118	17

Chain D: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	8-9	2	5
α-helix	12-16	5
β-strand	25-36	12	5
β-strand	41-48	8	5
β-strand	51-58	8	5
α-helix	60-62	3
α-helix	63	1
α-helix	65	1
β-strand	72-80	9	5
β-strand	88-96	9	5
α-helix	102-118	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit STN1	A, B	protein	166	Homo sapiens	Q9H668 (AlphaFold model)
CST complex subunit TEN1	C, D	protein	122	Homo sapiens	Q86WV5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JOI_1 CST complex subunit STN1 (chains A, B)
LDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVD
DSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSI
RTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHS

Sequence of entity 2 (C, D), FASTA

>4JOI_2 CST complex subunit TEN1 (chains C, D)
MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKL
VEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGG
SQ

Primary citation

Structure of the human telomeric stn1-ten1 capping complex. Bryan, C., Rice, C., Harkisheimer, M. et al. PLoS One (2013) 8:e66756-e66756. DOI 10.1371/journal.pone.0066756 · PubMed

Other PDB entries of the same protein (UniProt Q9H668 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQF 1.6 Å, Structure of the C-terminal domain of human telomeric Stn1
6W6W 3.0 Å, Cryo-EM structure of CST bound to telomeric single-stranded DNA
8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
8SOK 4.1 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA
8D0K 4.27 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…

Browse structure collections

About this viewer

MolViewer shows 4JOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.