4JQF: C-terminal domain of human telomeric Stn1

Structure of the C-terminal domain of human telomeric Stn1. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Jun 2013.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,516
Mol. weight: 20.47 kDa
Released: 5 Jun 2013

Explore 4JQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JQF contains 12 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	191-194	4
α-helix	196-198	3
α-helix	201-218	18
β-strand	223-225	3	1
α-helix	226-230	5
α-helix	233-239	7
α-helix	242-245	4
α-helix	259-276	18
β-strand	280-281	2	1
β-strand	290-293	4	1
α-helix	294-296	3
α-helix	298-309	12
α-helix	311-313	3
β-strand	322-323	2	2
α-helix	324-334	11
α-helix	341-353	13
β-strand	357-361	5	2
β-strand	364-367	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit STN1	A	protein	179	Homo sapiens	Q9H668 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JQF_1 CST complex subunit STN1 (chains A)
AEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASS
DQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQ
QDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF

Primary citation

Structure of the human telomeric stn1-ten1 capping complex. Bryan, C., Rice, C., Harkisheimer, M. et al. PLoS One (2013) 8:e66756-e66756. DOI 10.1371/journal.pone.0066756 · PubMed

Other PDB entries of the same protein (UniProt Q9H668 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JOI 2.05 Å, Crystal structure of the human telomeric Stn1-Ten1 complex
6W6W 3.0 Å, Cryo-EM structure of CST bound to telomeric single-stranded DNA
8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
8SOK 4.1 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA
8D0K 4.27 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…

Browse structure collections

About this viewer

MolViewer shows 4JQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.