4JUY: PUB domain of E3 ubiquitin ligase RNF31

Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31. Determined by X-ray diffraction at 2.4 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,955
Mol. weight: 45.35 kDa
Released: 10 Apr 2013

Explore 4JUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JUY contains 23 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	18-19	2
α-helix	24-42	19
α-helix	50-57	8
α-helix	63-66	4
α-helix	72-77	6
α-helix	84-106	23
β-strand	116-118	3	1
α-helix	122-126	5
α-helix	134-141	8
β-strand	145-146	2	1
β-strand	150-152	3	1
α-helix	162-183	22
α-helix	192-197	6

Chain B: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	18-19	2
α-helix	24-42	19
α-helix	50-58	9
α-helix	63-66	4
α-helix	72-77	6
α-helix	84-104	21
β-strand	116-118	3	2
α-helix	122-126	5
α-helix	128-130	3
α-helix	134-141	8
β-strand	145-146	2	2
β-strand	150-152	3	2
α-helix	162-183	22
α-helix	192-197	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF31	A, B	protein	198	Homo sapiens	Q96EP0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JUY_1 E3 ubiquitin-protein ligase RNF31 (chains A, B)
MHHHHHHSSGRENLYFQGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSL
PLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNN
PVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSL
LLQNTHPRQQALEQLLED

Primary citation

Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31. Hu, J., Dong, A., Li, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q96EP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KC5 1.54 Å, HOIP-HOIPIN1 complex
4LJO 1.56 Å, Structure of an active ligase (HOIP)/ubiquitin transfer complex
7V8F 1.66 Å, Crystal structure of UBE2L3 bound to HOIP RING1 domain.
4P09 1.7 Å, Crystal structure of HOIP PUB domain
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
4OWF 2.0 Å, Crystal structure of the NEMO CoZi in complex with HOIP NZF1 domain
4OYK 2.0 Å, Structure of HOIP PUB domain bound to OTULIN PIM
6SC5 2.1 Å, dAb3/HOIP-RBR-Ligand2
6SC8 2.11 Å, dAb3/HOIP-RBR-Ligand4
6KC6 2.12 Å, HOIP-HOIPIN8 complex
4LJP 2.15 Å, Structure of an active ligase (HOIP-H889A)/ubiquitin transfer complex

Browse structure collections

About this viewer

MolViewer shows 4JUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.