4JV4: RIalpha(91-379)

Crystal Structure of RIalpha(91-379) bound to HE33, a N6 di-propyl substituted cAMP analog. Determined by X-ray diffraction at 2.95 Å resolution. Released 18 Sept 2013.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Bos taurus
Chains: 1
Atoms: 2,021
Mol. weight: 33.32 kDa
Ligands: 1OR
Released: 18 Sept 2013

Explore 4JV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JV4 contains 16 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	120-132	13
α-helix	134-136	3
α-helix	141-150	10
β-strand	152-156	5	1
β-strand	161-163	3	2
β-strand	168	1	3
α-helix	169	1
β-strand	171-177	7	1
β-strand	180-184	5	2
β-strand	187-192	6	2
β-strand	197-198	2	1
α-helix	201-204	4
α-helix	207	1
β-strand	208	1	3
α-helix	209	1
β-strand	212-215	4	2
β-strand	219-225	7	1
α-helix	226-229	4
α-helix	230-234	5
α-helix	235-249	15
α-helix	252-255	4
α-helix	259-268	10
β-strand	270-274	5	4
β-strand	277-281	5	4
β-strand	284	1	5
β-strand	289	1	6
β-strand	291-301	11	4
β-strand	312-316	5	4
β-strand	321-322	2	4
α-helix	325-328	4
β-strand	333	1	5
β-strand	336-347	12	4
β-strand	349	1	6
α-helix	350-356	7
α-helix	361-366	6
α-helix	368-370	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory subunit	A	protein	288	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JV4_1 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains A)
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAM
FPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAA
TVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEP
VQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV

Ligands and cofactors

ID	Name	Formula	Copies
1OR	(2R,4aR,6R,7R,7aS)-6-[6-(dipropylamino)-9H-purin-9-yl]tetrahydro-4H-furo[3,2-d]…	C16 H24 N5 O6 P	2

Primary citation

Implementing Fluorescence Anisotropy Screening and Crystallographic Analysis to Define PKA Isoform-Selective Activation by cAMP Analogs. Brown, S.H., Cheng, C.Y., Saldanha, S.A. et al. ACS Chem Biol (2013) 8:2164-2172. DOI 10.1021/cb400247t · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 4JV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.