4JZC: Angiopoietin-2 fibrinogen domain TAG mutant

Angiopoietin-2 fibrinogen domain TAG mutant. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,937
Mol. weight: 24.82 kDa
Released: 8 May 2013

Explore 4JZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JZC contains 7 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	6-11	6
β-strand	18-23	6	1
β-strand	30-36	7	1
β-strand	44-50	7	1
α-helix	61-66	6
β-strand	68-69	2	1
β-strand	75-76	2	1
α-helix	79-86	8
β-strand	91-98	8	1
β-strand	104-114	11	1
α-helix	117-119	3
β-strand	123-130	8	1
α-helix	143-145	3
β-strand	146	1	2
β-strand	147	1	3
β-strand	150	1	3
α-helix	159-163	5
β-strand	167	1	2
β-strand	175-176	2	4
β-strand	180	1	5
β-strand	193	1	5
β-strand	195-196	2	4
α-helix	197-200	4
β-strand	201	1	4
β-strand	208-215	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiopoietin-2	A	protein	218	Homo sapiens	O15123 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JZC_1 Angiopoietin-2 (chains A)
ISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRT
WKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELN
YRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGM
YYTAGQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Primary citation

Structural basis for angiopoietin-1-mediated signaling initiation. Yu, X., Seegar, T.C., Dalton, A.C. et al. Proc Natl Acad Sci U S A (2013) 110:7205-7210. DOI 10.1073/pnas.1216890110 · PubMed

Other PDB entries of the same protein (UniProt O15123 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Z3U 2.25 Å, Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces…
4ZFG 2.27 Å, Dual-specificity Fab 5A12 in complex with Angiopoietin 2
1Z3S 2.35 Å, Angiopoietin-2 Receptor Binding Domain
8VGP 2.7 Å, CryoEM structure of Angiopoietin-2 in complex with engineered conformationally rigid Fab…
9HMI 2.87 Å, Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2…
2GY7 3.7 Å, Angiopoietin-2/Tie2 Complex Crystal Structure

Browse structure collections

About this viewer

MolViewer shows 4JZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.