2GY7: Angiopoietin-2/Tie2 Complex Crystal Structure

Angiopoietin-2/Tie2 Complex Crystal Structure. Determined by X-ray diffraction at 3.7 Å resolution. Released 6 Jun 2006.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,169
Mol. weight: 74.07 kDa
Ligands: CA, NAG
Released: 6 Jun 2006

Explore 2GY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GY7 contains 14 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	284-289	6
β-strand	296-301	6	1
β-strand	308-313	6	1
β-strand	323-326	4	1
α-helix	341-344	4
α-helix	357-365	9
β-strand	369-377	9	1
β-strand	381-391	11	1
β-strand	402-408	7	1
β-strand	424	1	2
α-helix	437-441	5
β-strand	445	1	2
β-strand	454	1	3
α-helix	462-464	3
β-strand	473	1	3
α-helix	475-477	3
β-strand	486-491	6	1

Chain B: 8 helices, 56 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	4
β-strand	34-35	2	5
β-strand	40-46	7	4
α-helix	54-55	2
β-strand	58-59	2	6
β-strand	75-77	3	4
β-strand	83-88	6	4
β-strand	98-101	4	6
β-strand	103	1	7
β-strand	112	1	7
β-strand	115-117	3	6
β-strand	118-119	2	5
β-strand	124-125	2	8
β-strand	132-134	3	9
β-strand	139-140	2	10
β-strand	144-145	2	8
β-strand	153-157	5	11
β-strand	160-165	6	11
α-helix	167-169	3
β-strand	173	1	8
β-strand	177-178	2	10
α-helix	183-185	3
β-strand	187-188	2	12
β-strand	189-193	5	11
β-strand	202	1	11
β-strand	205-206	2	12
β-strand	207-209	3	9
β-strand	215-216	2	13
β-strand	222-223	2	13
β-strand	232-233	2	14
β-strand	240-241	2	14
β-strand	246-247	2	15
β-strand	253-254	2	15
β-strand	259-260	2	16
β-strand	266-267	2	16
β-strand	277-281	5	4
β-strand	286-289	4	4
α-helix	290	1
β-strand	291	1	17
β-strand	294	1	18
β-strand	300	1	18
β-strand	306	1	19
β-strand	309	1	17
β-strand	314	1	19
β-strand	323-324	2	20
β-strand	328-329	2	20
α-helix	331-332	2
β-strand	335-336	2	21
β-strand	342-343	2	21
α-helix	346-347	2
β-strand	352	1	22
β-strand	362	1	23
β-strand	364-366	3	24
β-strand	369-372	4	22
α-helix	380-382	3
β-strand	383-386	4	25
β-strand	392-393	2	25
β-strand	397-398	2	22
β-strand	405-408	4	22
β-strand	411-414	4	24
α-helix	416-418	3
β-strand	420-428	9	25
β-strand	431-439	9	25
β-strand	442	1	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiopoietin-2	A	protein	216	Homo sapiens	O15123 (AlphaFold model)
Angiopoietin-1 receptor	B	protein	423	Homo sapiens	Q02763 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GY7_1 Angiopoietin-2 (chains A)
EFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTW
KEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNY
RIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMY
YPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD

Sequence of entity 2 (B), FASTA

>2GY7_2 Angiopoietin-1 receptor (chains B)
AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREW
AKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNIS
FKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSA
FTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGR
TCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEM
CDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEE
MTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVK
VLP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex. Barton, W.A., Tzvetkova-Robev, D., Miranda, E.P. et al. Nat Struct Mol Biol (2006) 13:524-532. DOI 10.1038/nsmb1101 · PubMed

Other PDB entries of the same protein (UniProt O15123 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JZC 1.9 Å, Angiopoietin-2 fibrinogen domain TAG mutant
1Z3U 2.25 Å, Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces…
4ZFG 2.27 Å, Dual-specificity Fab 5A12 in complex with Angiopoietin 2
1Z3S 2.35 Å, Angiopoietin-2 Receptor Binding Domain
8VGP 2.7 Å, CryoEM structure of Angiopoietin-2 in complex with engineered conformationally rigid Fab…
9HMI 2.87 Å, Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2…

Browse structure collections

About this viewer

MolViewer shows 2GY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.