Dual-specificity Fab 5A12 in complex with Angiopoietin 2. Determined by X-ray diffraction at 2.27 Å resolution. Released 1 Jul 2015.
Explore 4ZFG in 3D Show helices and sheets RCSB PDB PDBe
4ZFG contains 25 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 284-289 | 6 | |
| β-strand | 296-301 | 6 | 1 |
| β-strand | 308-314 | 7 | 1 |
| α-helix | 317-319 | 3 | |
| β-strand | 322-328 | 7 | 1 |
| α-helix | 339-344 | 6 | |
| β-strand | 346-347 | 2 | 1 |
| β-strand | 353-354 | 2 | 1 |
| α-helix | 357-366 | 10 | |
| β-strand | 369-376 | 8 | 1 |
| β-strand | 382-392 | 11 | 1 |
| α-helix | 395-397 | 3 | |
| β-strand | 401-408 | 8 | 1 |
| α-helix | 421-423 | 3 | |
| β-strand | 424 | 1 | 2 |
| β-strand | 425 | 1 | 3 |
| β-strand | 428 | 1 | 3 |
| α-helix | 437-441 | 5 | |
| β-strand | 445 | 1 | 2 |
| β-strand | 453-454 | 2 | 4 |
| β-strand | 473-474 | 2 | 4 |
| α-helix | 475-478 | 4 | |
| α-helix | 482-484 | 3 | |
| β-strand | 486-493 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 5 |
| β-strand | 10-12 | 3 | 6 |
| β-strand | 18-25 | 8 | 5 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 6 |
| β-strand | 46-52 | 7 | 6 |
| β-strand | 56-59 | 4 | 6 |
| β-strand | 67-72 | 6 | 5 |
| β-strand | 77-82 | 6 | 5 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 6 |
| β-strand | 100C-103 | 4 | 6 |
| β-strand | 107-111 | 5 | 6 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 7 |
| β-strand | 120-124 | 5 | 8 |
| β-strand | 135-145 | 11 | 8 |
| β-strand | 146 | 1 | 7 |
| β-strand | 151-154 | 4 | 9 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 9 |
| β-strand | 163-165 | 3 | 8 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 8 |
| β-strand | 176-185 | 10 | 8 |
| β-strand | 189 | 1 | 10 |
| β-strand | 192 | 1 | 10 |
| β-strand | 195-200 | 6 | 9 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 11 |
| β-strand | 10-14 | 5 | 12 |
| β-strand | 19-28 | 11 | 11 |
| α-helix | 30-32 | 3 | |
| β-strand | 33-38 | 6 | 12 |
| β-strand | 45-49 | 5 | 12 |
| β-strand | 53-54 | 2 | 12 |
| α-helix | 55 | 1 | |
| β-strand | 62-75 | 14 | 11 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 12 |
| α-helix | 97 | 1 | |
| β-strand | 98 | 1 | 12 |
| α-helix | 99 | 1 | |
| β-strand | 102-107 | 6 | 12 |
| β-strand | 111 | 1 | 13 |
| β-strand | 114-118 | 5 | 14 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 14 |
| β-strand | 140 | 1 | 13 |
| β-strand | 145-150 | 6 | 15 |
| β-strand | 153-154 | 2 | 15 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 14 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 14 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 15 |
| β-strand | 205-210 | 6 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiopoietin-2 | A | protein | 232 | Homo sapiens | O15123 (AlphaFold model) |
| Fragment antigen binding 5A12 heavy chain | H | protein | 228 | Homo sapiens | |
| Fragment antigen binding 5A12 light chain | L | protein | 215 | Homo sapiens |
>4ZFG_1 Angiopoietin-2 (chains A) AGSEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSV DFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLS SEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPS NLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFGNSHHHHHH
>4ZFG_2 Fragment antigen binding 5A12 heavy chain (chains H) EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYY ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>4ZFG_3 Fragment antigen binding 5A12 light chain (chains L) DIQMTQSPSSLSASVGDRVTITCRASQFLSSFGVAWYQQKPGKAPKLLIYGASSLYSGVP SRFSGSGSGTDFTLTISSLQPEDFATYYCQQGLLSPLTFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4) are not listed.
Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration. Koenig, P., Lee, C.V., Sanowar, S. et al. J Biol Chem (2015) 290:21773-21786. DOI 10.1074/jbc.M115.662783 · PubMed
Other PDB entries of the same protein (UniProt O15123 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.