Crystal structures of Drosophila Cryptochrome. Determined by X-ray diffraction at 2.34 Å resolution. Released 26 Jun 2013.
Explore 4JZY in 3D Show helices and sheets RCSB PDB PDBe
4JZY contains 72 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| α-helix | 21-27 | 7 | |
| α-helix | 30-32 | 3 | |
| β-strand | 35-42 | 8 | 1 |
| α-helix | 54-73 | 20 | |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 88-98 | 11 | |
| β-strand | 101-107 | 7 | 1 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131-135 | 5 | 1 |
| α-helix | 143-149 | 7 | |
| α-helix | 158-168 | 11 | |
| α-helix | 171-178 | 8 | |
| β-strand | 185 | 1 | 1 |
| α-helix | 187-189 | 3 | |
| α-helix | 190-195 | 6 | |
| β-strand | 198 | 1 | 1 |
| α-helix | 205-208 | 4 | |
| β-strand | 213-214 | 2 | 2 |
| β-strand | 217-218 | 2 | 2 |
| α-helix | 219 | 1 | |
| α-helix | 227-246 | 20 | |
| α-helix | 267-272 | 6 | |
| α-helix | 277-288 | 12 | |
| α-helix | 306-322 | 17 | |
| α-helix | 342-345 | 4 | |
| α-helix | 347-355 | 9 | |
| α-helix | 361-373 | 13 | |
| α-helix | 378-388 | 11 | |
| α-helix | 397-407 | 11 | |
| α-helix | 413-424 | 12 | |
| α-helix | 430-432 | 3 | |
| α-helix | 440-447 | 8 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 466-469 | 4 | |
| α-helix | 472-474 | 3 | |
| α-helix | 477-482 | 6 | |
| β-strand | 487 | 1 | 3 |
| β-strand | 491 | 1 | 3 |
| α-helix | 492-494 | 3 | |
| α-helix | 498-515 | 18 | |
| α-helix | 528-534 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-4 | 4 | |
| β-strand | 6-11 | 6 | 4 |
| α-helix | 21-27 | 7 | |
| α-helix | 30-32 | 3 | |
| β-strand | 35-42 | 8 | 4 |
| α-helix | 54-74 | 21 | |
| β-strand | 82-85 | 4 | 4 |
| α-helix | 88-98 | 11 | |
| β-strand | 101-107 | 7 | 4 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131-135 | 5 | 4 |
| α-helix | 143-149 | 7 | |
| α-helix | 158-168 | 11 | |
| α-helix | 171-174 | 4 | |
| α-helix | 176-178 | 3 | |
| α-helix | 186-189 | 4 | |
| α-helix | 190-195 | 6 | |
| β-strand | 198 | 1 | 4 |
| α-helix | 202-204 | 3 | |
| α-helix | 205-208 | 4 | |
| β-strand | 213-214 | 2 | 5 |
| β-strand | 217-218 | 2 | 5 |
| α-helix | 219 | 1 | |
| α-helix | 227-246 | 20 | |
| α-helix | 252-254 | 3 | |
| α-helix | 267-272 | 6 | |
| α-helix | 277-286 | 10 | |
| α-helix | 306-322 | 17 | |
| α-helix | 342-345 | 4 | |
| α-helix | 347-355 | 9 | |
| α-helix | 361-373 | 13 | |
| α-helix | 378-388 | 11 | |
| α-helix | 397-407 | 11 | |
| α-helix | 413-424 | 12 | |
| α-helix | 430-433 | 4 | |
| α-helix | 435-438 | 4 | |
| α-helix | 440-447 | 8 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 466-469 | 4 | |
| α-helix | 472-474 | 3 | |
| α-helix | 477-482 | 6 | |
| β-strand | 487 | 1 | 6 |
| β-strand | 491 | 1 | 6 |
| α-helix | 492-494 | 3 | |
| α-helix | 498-516 | 19 | |
| α-helix | 519-520 | 2 | |
| α-helix | 528-534 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A, B | protein | 536 | Drosophila melanogaster | O77059 (AlphaFold model) |
>4JZY_1 Cryptochrome-1 (chains A, B) AMATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRF LLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDE SIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADAR LEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLK VEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTG GAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLID GAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVS SSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYE CLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
| ID | Name | Formula | Copies |
|---|---|---|---|
| FAD | Flavin-adenine dinucleotide | C27 H33 N9 O15 P2 | 2 |
Water and common crystallization additives (NA, NH4) are not listed.
Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function. Czarna, A., Berndt, A., Singh, H.R. et al. Cell (2013) 153:1394-1405. DOI 10.1016/j.cell.2013.05.011 · PubMed
Other PDB entries of the same protein (UniProt O77059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.